NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51862.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51862.1 Public Mus musculus 6 Mitf 16 104 75 CCDS HistoryNCBI Gene:17342Re-query CCDS DB by CCDS ID:51862.1Re-query CCDS DB by GeneID:17342See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51862.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101123 ENSMUSP00000098683 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101123Link to Ensembl Protein Viewer:ENSMUSP00000098683Re-query CCDS DB by Nucleotide ID:ENSMUST00000101123Re-query CCDS DB by Protein ID:ENSMUSP00000098683
Original member Current member EBI,WTSI OTTMUST00000056378 OTTMUSP00000027090 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000056378Link to Vega Protein Viewer:OTTMUSP00000027090Re-query CCDS DB by Nucleotide ID:OTTMUST00000056378Re-query CCDS DB by Protein ID:OTTMUSP00000027090
Original member Current member NCBI NM_001178049.1 NP_001171520.1 Accepted alive Link to Nucleotide Sequence:NM_001178049.1Link to Protein Sequence:NP_001171520.1Re-query CCDS DB by Nucleotide ID:NM_001178049Re-query CCDS DB by Protein ID:NP_001171520Link to BLink:NP_001171520.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001171520.1 510 Q08874-4 510 99.4118% 0 3

Chromosomal Locations for CCDS 51862.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 97929878 97929933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 97941053 97941302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 97993127 97993354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 97994381 97994464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 97996374 97996469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 98003887 98004004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 98006123 98006197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 98010395 98010470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 98013669 98013816 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 98017774 98018175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1533 nt):
ATGGAGGCGCTTAGATTTGAGATGCTCATCCCCTGCTCCTTTGAAAGCTTGTGTCTCAGTTCTGCAGAGC
AT
TCTGGGGCCTCCAAGCCTCCGTTAAGCTCCTCCACTATGACATCACGCATCTTGCTACGCCAGCAACT
C
ATGCGTGAGCAGATGCAGGAGCAGGAGCGCAGGGAGCAGCAGCAGAAGCTGCAGGCAGCCCAGTTCATG
CAA
CAGAGAGTGGCCGTGAGTCAGACACCAGCCATAAACGTCAGCGTGCCCACCACCCTTCCCTCTGCCA
CC
CAGGTGCCGATGGAAGTCCTTAAGGTGCAGACCCACCTGGAAAACCCCACCAAGTACCACATACAGCA
A
GCTCAGAGGCACCAGGTAAAGCAGTACCTTTCTACCACTTTAGCAAATAAACATGCCAGCCAAGTCCTG
AGC
TCACCATGTCCAAACCAGCCTGGCGACCATGCCATGCCACCAGTGCCGGGGAGCAGCGCACCCAACA
GC
CCTATGGCTATGCTCACTCTTAACTCCAACTGTGAAAAAGAGGCATTTTATAAGTTTGAGGAGCAGAG
C
AGGGCAGAGAGTGAGTGCCCAGGTATGAACACGCACTCTCGAGCGTCGTGCATGCAGATGGATGATGTA
ATT
GATGACATCATCAGCCTGGAATCAAGTTATAATGAAGAAATTTTGGGCTTGATGGATCCGGCCTTGC
AA
ATGGCAAATACGTTACCCGTCTCTGGAAACTTGATCGACCTCTACAGCAACCAGGGCCTGCCACCGCC
A
GGCCTTACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATT
TTC
CCCACAGAGTCTGAAGCAAGAGCATTGGCTAAAGAGAGGCAGAAAAAGGACAATCACAACTTGATTG
AA
CGAAGAAGAAGATTTAACATAAACGACCGCATTAAGGAGCTAGGTACTCTGATCCCCAAGTCAAATGA
T
CCAGACATGCGGTGGAACAAGGGAACCATTCTCAAGGCCTCTGTGGACTACATCCGGAAGTTGCAACGG
GAA
CAGCAACGAGCTAAGGACCTTGAAAACCGACAGAAGAAGCTGGAGCATGCGAACCGGCACCTGCTGC
TC
AGAGTACAGGAGCTGGAGATGCAGGCTAGAGCGCATGGACTTTCCCTTATCCCATCCACCGGTCTCTG
C
TCGCCTGATCTGGTGAATCGGATCATCAAGCAAGAACCAGTTCTTGAGAACTGCAGCCAGGAACTTGTA
CAG
CACCAGGCAGACCTGACATGTACGACAACTCTGGATCTCACGGACGGTACCATCACCTTTACCAACA
AC
CTCGGCACCATGCCGGAGAGCAGCCCGGCCTACAGCATCCCCAGGAAGATGGGCTCCAACTTGGAAGA
C
ATCCTGATGGACGATGCCCTCTCACCTGTTGGAGTCACCGACCCACTGCTGTCATCAGTGTCGCCAGGA
GCT
TCAAAAACAAGCAGCCGGAGGAGCAGTATGAGCGCAGAAGAAACGGAGCATGCGTGTTAG


Translation (510 aa):
MEALRFEMLIPCSFESLCLSSAEHSGASKPPLSSSTMTSRILLRQQLMREQMQEQERREQQQKLQAAQFM
Q
QRVAVSQTPAINVSVPTTLPSATQVPMEVLK
VQTHLENPTKYHIQQAQRHQVKQYLSTTLANKHASQVL
S
SPCPNQPGDHAMPPVPGSSAPNSPMAMLTLNSNCEKE
AFYKFEEQSRAESECPGMNTHSRASCMQMDDV
I
DDIISLESSYNEEILGLMDPALQMANT
LPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTACI
F
PTESEARALAKERQKKDNHNL
IERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQR
E
QQRAKDLENRQKKLEHANRHLLLRVQ
ELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQELV
Q
HQADLTCTTTLDLTDGTITFTNNLGTMPESSPAYSIPRKMGSNLEDILMDDALSPVGVTDPLLSSVSPG
A
SKTSSRRSSMSAEETEHAC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser