NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51686.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51686.1 Public Mus musculus 5 Card11 16 104 75 CCDS HistoryNCBI Gene:108723Re-query CCDS DB by CCDS ID:51686.1Re-query CCDS DB by GeneID:108723See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51686.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000085786 ENSMUSP00000082941 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000085786Link to Ensembl Protein Viewer:ENSMUSP00000082941Re-query CCDS DB by Nucleotide ID:ENSMUST00000085786Re-query CCDS DB by Protein ID:ENSMUSP00000082941
Original member Current member NCBI NM_175362.2 NP_780571.2 Accepted alive Link to Nucleotide Sequence:NM_175362.2Link to Protein Sequence:NP_780571.2Re-query CCDS DB by Nucleotide ID:NM_175362Re-query CCDS DB by Protein ID:NP_780571Link to BLink:NP_780571.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780571.2 1154 Q8CIS0-2 1154 100% 0 0

Chromosomal Locations for CCDS 51686.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 140873325 140873529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140874341 140874456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140876397 140876521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140877963 140878142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140880298 140880433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140882002 140882097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140882285 140882381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140883530 140883770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140885478 140885604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140885803 140886004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140887017 140887149 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140889101 140889153 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140889969 140890069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140890986 140891068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140893064 140893115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140895890 140896066 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140898182 140898379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140899660 140899785 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140900976 140901128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140902738 140902917 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140906625 140906950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140908515 140908652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140913198 140913410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 140927721 140927727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3465 nt):
ATGCCAGGAGGAGGGCCAGCTATGGATGACTACATGGAGACGCTGAAGGATGAAGAGGAGGCCCTATGGG
AT
AACGTGGAATGCAACCGGCACATGCTGAGCCGTTACATCAACCCCGCCAAGCTCACCCCCTACCTGCG
C
CAGTGCAAGGTCATCGATGAGCAAGATGAAGACGAGGTGCTCAATGCGCCCATGCTGCCGTCCAAGATC
AAC
CGTGCAGGCCGATTGTTGGACATTCTTCACACCAAGGGACAAAGGGGCTATGTGGTCTTCCTGGAGA
GC
CTGGAGTTTTACTACCCAGAACTTTACAAACTGGTGACTGGAAAGGAACCCACCCGGAGATTCTCCAC
C
ATTGTGGTGGAGGAAGGCCATGAGGGCCTCACACACTTCCTGATGAACGAGGTCATCAAACTGCAGCAG
CAA
GTGAAAGCCAAGGACCTTCAGCGCTGTGAGCTGCTGGCCAAGTCCCGGCAACTGGAGGATGAGAAGA
AG
CAGCTGAGCCTGATACGGGTGGAGCTGCTGACCTTCCAGGAGCGATACTACAAGATGAAGGAGGAGCG
G
GACAGCTACAATGACGAGCTCGTCAAGGTCAAGGACGACAACTACAACTTAGCCATGCGCTACGCCCAG
CTC
AGTGAGGAGAAAAACATGGCGGTGATGAGGAGCCGCGACCTCCAACTCGAGATCGACCAGCTCAAAC
AC
CGACTGAACAAGATGGAGGAGGAATGCAAGCTGGAGAGAAATCAGTCCCTCAAGCTCAAGAATGACAT
C
GAGAACCGGCCCAGGAAGGAGCAGGTCCTGGAGCTGGAGCGGGAGAATGAGATGCTGAAGACGAAAATT
CAG
GAGCTGCAGTCCATCATCCAGGCTGGCAAGCGCAGCCTCCCTGACTCAGACAAGGCCATCTTGGACA
TC
CTGGAACATGACCGGAAGGAGGCGCTAGAGGACCGGCAGGAACTGGTCAACAAAATTTACAACCTACA
A
GAGGAAGTCCGCCAGGCGGAGGAGCTGCGGGATAAGTACCTGGAGGAGAAGGAAGACCTGGAACTCAAG
TGT
TCAACCCTGGGGAAGGACTGTGAAATGTACAAGCACCGCATGAACACAGTTATGCTGCAGCTGGAGG
AG
GTGGAGCGGGAGCGGGACCAGGCCTTCCACTCCCGAGATGAGGCACAGACACAGTACTCACAGTGCTT
A
ATCGAGAAGGACAAGTACCGGAAGCAGATCCGGGAGCTGGAGGAGAAGAACGATGAGATGCGTATTGAG
ATG
GTGAGGAGGGAGGCCTGTATTGTCAACCTGGAAAGCAAGCTCCGGCGCCTGTCCAAGGACAACGGCA
GC
CTCGACCAGAGTCTGCCTAGACACCTTCCAGCCACCATCATCTCACAGAACCTTGGAGACACCAGCCC
C
AGGACCAATGGCCAGGAAGCTGATGATTCTTCAACCTCAGAAGAGTCTCCCGAAGACAGCAAGTACTTT
CTG
CCTTACCACCCACCCCGGCGCCGGATGAACCTAAAGGGCATCCAGCTGCAGAGAGCCAAATCCCCCA
TC
AGCATGAAGCAAGCATCTGAGTTTCAAGTCAAGGGGCACGAAGAGGATTTCACAGACGGCAGCCCCAG
T
TCCTCCCGCTCGCTGCCTGTCACCAGCTCTTTCTCCAAGATGCAACCCCATCGGAGCCGCAGCAGCATC
ATG
TCAATCACGGCAGAGCCCCCGGGAAATGACTCCATAGTCAGACGCTGTAAGGAAGATGCGCCACACC
GG
AGCACGGTGGAAGAAGACAACGATAGCTGTGGGTTTGATGCCTTAGACCTTGACGATGAAAATCACGA
A
CGTTATTCCTTTGGACCTCCCTCCATCCACTCCTCCTCCTCTTCACACCAGTCAGAGGGACTGGATGCC
TAC
GACCTGGAGCAGGTCAACCTCATGTTACGAAAGTTCTCTTTGGAAAGGCCCTTCCGGCCATCGGTCA
CA
TCTGGGGGTCACGTGCGGGGCACCGGGCCCTTGGTCCAGCACACAACTCTGAATGGCGATGGGCTCAT
C
ACGCAGCTCACCCTTCTGGGCGGCAATGCACGCGGGAGCTTCATTCACTCTGTCAAGCCAGGCTCACTG
GCT
GAGAGGGCCGGACTGCGTGAGGGCCACCAACTCCTGCTGCTGGAAGGTTGCATCCGAGGCGAAAGGC
AG
AGCGTTCCACTGGATGCGTGCACAAAAGAAGAGGCCCGTTGGACCATCCAGAGGTGCAGTGGCCTCAT
C
ACTCTGCATTACAAGGTCAACCATGAAGGATACCGGAAGCTGCTGAAGGAGATGGAGGATGGTCTGATC
ACA
TCAGGGGACTCGTTCTATATCCGCCTGAACCTGAACATCTCCAGCCAGCTGGATGCCTGCTCCATGT
CC
CTCAAGTGTGACGACGTGGTGCATGTCCTAGACACCATGTACCAGGACAGGCACGAGTGGCTGTGTGC
A
CGAGTCGACCCCTTCACTGACCAAGACCTGGACACGGGCACCATCCCCAGCTACAGCCGGGCTCAACAG
CTT
CTCCTGGTGAAGCTCCAGCGGTTGGTTCACAGAGGCAACCGGGAAGAGGCAGACAGCGCTCACCACA
CC
CTGCGCAGCCTCCGGAACACCCTGCAGCCCGAAGAGATGCTTTCGACGAGCGACCCCCGAGTCAGCCC
C
CGCCTCTCCAGAGCGAGTTTCTTCTTTGGCCAGCTCCTGCAGTTTGTCAGCCGGTCAGAAAACAAGTAC
AAA
AGAATGAACAGCAATGAGCGCGTGAGAATCATCTCTGGGAGTCCCCTGGGGAGCCTCTCCCGGTCCT
CG
CTGGATGCCACCAAACTCCTGACCGAGAAGCATGAAGAACTGGATCCTGAGAATGAGCTCAGCCGGAA
C
CTCACCCTGATCCCTTACAGCCTGGTGCGCGCTTTCCACTGTGAGCGCCGCAGGCCTGTGCTCTTCACG
CCC
ACCATGCTGGCCAAGACATTGGTGCAGAAGCTGCTCAACTCAGGGGGTGCCATGGAGTTCACCATCT
GC
AAGTCAGATATTGTCACAAGAGATGAGTTCCTCCGAAAGCAGAAGACAGAGACCATCATCTACTCCCG
G
GAAAAGAACCCCAACACCTTTGAATGCATCGTCCCTGCCAACATTGAGGCTGTGGCAGCCAAGAACAAA
CAC
TGCCTGCTGGAGGCTGGGATCGGCTGTGTGCGCGACCTGATCAAGTGCAAGGTGTACCCCATAGTGC
TG
CTCATCCGGGTGAGCGAGAAGAACATCAAACGGTTCAGGAAGCTGCTGCCGCGGCCAGAGACGGAAGA
G
GAATTCCTGCGAGTGTGCAGGCTCAAAGAGAAGGAGCTGGAGGCGCTGCCCTGCCTCTACGCCACCGTG
GAA
GCTGAGATGTGGAGCAGCGTGGAGGAGCTGCTGCGAGTCCTCAAAGACAAGATTGTAGAGGAGCAGC
GC
AAGACCATCTGGGTGGACGAGGACCAGCTGTGA


Translation (1154 aa):
MPGGGPAMDDYMETLKDEEEALWDNVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKI
N
RA
GRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQ
Q
VKAKDLQRCELLAKSRQLEDEKKQLSLIRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQ
L
SEEKNMAVMRSRDLQLE
IDQLKHRLNKMEEECKLERNQSLKLKNDIENRPRKEQVLELERENEMLKTKI
Q
ELQSIIQ
AGKRSLPDSDKAILDILEHDRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEKEDLELK
C
STLGKDCEMYKHRMNTVMLQLEEVERERDQ
AFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
M
VRREACIVNLESKLRRLSKDNGSLDQ
SLPRHLPATIISQNLGDTSPRTNGQEADDSSTSEESPEDSKYF
L
PYHPPRRRMNLKGIQ
LQRAKSPISMKQASEFQVKGHEEDFTDGSPSSSRSLPVTSSFSKMQPHRSRSSI
M
SITAEPPGNDSIVRRCKEDAPHR
STVEEDNDSCGFDALDLDDENHERYSFGPPSIHSSSSSHQSEGLDA
Y
DLEQVNLMLRKFSLE
RPFRPSVTSGGHVRGTGPLVQHTTLNGDGLITQLTLLGGNARGSFIHSVKPGSL
A
ERAGLREGHQLLL
LEGCIRGERQSVPLDACTKEEARWTIQRCSGLITLHYKVNHEGYRKLLKEMEDGLI
T
SGDSFYIRLNLNISSQLDACSMSLKCDDVVHVLDTMYQDRHEWLCARVDPFTDQDLDTGTIPSYS
RAQQ
L
LLVKLQRLVHRGNREEADSAHHTLRSLR
NTLQPEEMLSTSDPRVSPRLSRASFFFGQLLQFVSRSENKY
K
RMNSNERVRIISGSPLGSLSRSSLDATKLLTEKHE
ELDPENELSRNLTLIPYSLVRAFHCERRRPVLFT
P
TMLAKTLVQKLLNSGGAMEFTICKS
DIVTRDEFLRKQKTETIIYSREKNPNTFECIVPANIEAVAAKNK
H
CLLEAGIGCVRDLIKCKVYPIVLLIRVSEKNIKRF
RKLLPRPETEEEFLRVCRLKEKELEALPCLYATV
E
AEMWSSVEELLRVLKDKIVEEQRKTIWVDEDQL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser