NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51541.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51541.1 Public Mus musculus 5 Slc4a4 19 105 81 CCDS HistoryNCBI Gene:54403Re-query CCDS DB by CCDS ID:51541.1Re-query CCDS DB by GeneID:54403See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51541.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000156238 ENSMUSP00000121744 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000156238Link to Ensembl Protein Viewer:ENSMUSP00000121744Re-query CCDS DB by Nucleotide ID:ENSMUST00000156238Re-query CCDS DB by Protein ID:ENSMUSP00000121744
Original member Current member EBI,WTSI OTTMUST00000063777 OTTMUSP00000031585 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000063777Link to Vega Protein Viewer:OTTMUSP00000031585Re-query CCDS DB by Nucleotide ID:OTTMUST00000063777Re-query CCDS DB by Protein ID:OTTMUSP00000031585
Original member Current member NCBI NM_001136260.1 NP_001129732.1 Accepted alive Link to Nucleotide Sequence:NM_001136260.1Link to Protein Sequence:NP_001129732.1Re-query CCDS DB by Nucleotide ID:NM_001136260Re-query CCDS DB by Protein ID:NP_001129732Link to BLink:NP_001129732.1

Chromosomal Locations for CCDS 51541.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 88934750 88934822 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 88954778 88954957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89028293 89028428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89038451 89038611 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89046213 89046392 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89084642 89084718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89122402 89122559 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89129639 89129726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89132371 89132525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89133157 89133270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89135646 89135820 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89149300 89149433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89156331 89156602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89170751 89170821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89179653 89179844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89197649 89197762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89199655 89199816 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89214474 89214652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89215721 89215793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89223196 89223264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89225800 89225973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89228826 89228987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89234797 89234876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 89235507 89235612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3285 nt):
ATGGAGGATGAAGCTGTCCTGGACAGAGGGGCTTCCTTCCTTAAACATGTGTGTGATGAAGAAGAAGTAG
AA
GGTCACCACACGATCTACATTGGGGTCCATGTGCCCAAGAGCTACCGGAGAAGGAGACGCCACAAGAG
G
AAGGCTGGGCACAAGGAAAAGAAGGAAAAGGAGAGAATCTCCGAGAACTACTCCGACAAATCTGATGTG
GAG
AATGCGGATGAGTCCAGCAGCAGTATCCTCAAACCCCTCATCTCCCCGGCCGCAGAACGCATCCGAT
TC
ATCTTGGGAGAGGAAGATGACAGCCCGGCACCTCCTCAGCTCTTCACGGAACTCGATGAGCTTCTGGC
T
GTGGATGGACAGGAGATGGAATGGAAGGAGACAGCGAGGTGGATTAAGTTTGAAGAGAAAGTGGAGCAG
GGT
GGGGAGCGATGGAGCAAACCCCATGTGGCCACCTTGTCCCTGCACAGCCTGTTTGAGCTGAGGACAT
GT
ATGGAGAAAGGATCCATCATGCTTGACCGGGAGGCATCTTCTCTCCCACAGCTGGTGGAGATGATTGC
A
GACCACCAGATCGAGACAGGCCTACTGAAGCCTGACCTGAAGGATAAGGTCACCTATACTCTGCTCCGG
AAA
CATCGACATCAAACCAAGAAATCCAACCTTCGGTCCCTGGCTGACATTGGGAAGACTGTCTCCAGTG
CA
AGTAGGATGTTTAGCAACCCTGATAATGGCAGCCCAGCCATGACCCACAGGAATCTGACATCCTCCAG
T
CTCAATGACATTTCTGATAAACCAGAGAAGGATCAGCTGAAGAATAAATTCATGAAAAAACTGCCCCGA
GAT
GCGGAAGCTTCCAATGTGCTTGTTGGGGAGGTTGACTTCTTGGACACTCCCTTCATTGCCTTTGTTC
GC
CTACAGCAGGCTGTCATGCTGGGTGCCCTGACTGAGGTCCCTGTGCCCACAAGGTTCTTGTTCATTCT
C
TTAGGTCCAAAGGGGAAAGCCAAGTCCTACCATGAGATTGGAAGAGCTATCGCCACCTTGATGTCTGAC
GAG
GTGTTCCACGACATCGCTTACAAAGCGAAAGACAGACACGACCTGATTGCTGGCATTGATGAGTTCT
TA
GATGAAGTCATTGTCCTTCCACCTGGGGAATGGGACCCCACAATCCGAATAGAGCCTCCAAAGAGTCT
C
CCATCATCTGACAAAAGAAAGAATATGTACTCAGGTGGAGAGAATGTTCAGATGAATGGGGACACACCT
CAT
GATGGAGGCCACGGAGGAGGAGGACATGGTGACTGTGAAGAACTACAGAGAACTGGCCGGTTCTGCG
GT
GGATTAATTAAGGACATAAAGAGGAAAGCACCATTTTTTGCCAGTGACTTTTATGATGCTTTAAACAT
T
CAGGCTCTCTCTGCGATTCTCTTCATTTATCTGGCAACCGTAACCAACGCCATCACTTTTGGAGGCCTG
CTC
GGGGATGCCACCGACAACATGCAGGGTGTGTTGGAGAGTTTCCTGGGCACTGCTGTCTCCGGAGCCA
TC
TTCTGCCTTTTTGCGGGTCAACCGCTTACCATCTTGAGCAGCACGGGACCAGTGTTGGTGTTTGAGAG
G
CTTCTTTTTAACTTCAGCAAGGACCATAATTTTGACTACTTGGAGTTTCGTCTTTGGATTGGCCTGTGG
TCA
GCCTTCATGTGTCTTGTCCTGGTGGCCACTGATGCGAGCTTCCTGGTTCAGTACTTCACCCGTTTCA
CA
GAAGAAGGTTTCTCCTCTCTCATCAGCTTCATCTTCATCTATGATGCTTTCAAGAAGATGATCAAGCT
A
GCAGATTACTATCCCATCAACTCTGACTTCAAAGTGGGTTACAATACTCACTTCTCTTGTGCTTGCCTG
CCA
CCCGACCCAGTTAATCTCTCAGTATCTAATGATACCACACTAGCCCCAGAGGACCTGCCGACCATTT
CT
TCTACTGACATGTACCATAATGTCACCTTTGACTGGGCCTATTTGTCAAAGAAGGAGTGTGTGAAGTA
T
GGAGGGAAGCTCGTGGGAAACAACTGTGACTTCGTGCCTGATATCACACTCATGTCCTTCATTCTCTTC
CTG
GGCACTTACACCTCGTCTATGGCTATGAAGAAATTCAAAACCAGTCGCTATTTTCCAACCACAGCAA
GA
AAACTGATCAGTGATTTTGCCATTATCCTGTCCATTCTCATATTCTGTGTAATAGATGCCCTAGTCGG
C
GTGGACACTCCGAAGCTCATTGTACCAAGTGAGTTCAAGCCAACAAGTCCTAACAGGGGTTGGTTTGTC
CCG
CCATTTGGAGGAAACCCTTGGTGGGTGTGCCTTGCTGCTGCCATCCCGGCTTTGCTAGTCACCATCC
TG
ATTTTCATGGACCAGCAGATCACCGCTGTGATTGTGAACAGGAAAGAGCATAAACTCAAGAAAGGAGC
T
GGGTATCACCTGGATCTGTTTTGGGTCGCCATCCTCATGGTGGTATGCTCCTTCATGGCTCTTCCCTGG
TAT
GTGGCTGCTACTGTTATCTCCATTGCCCACATTGACAGTCTGAAGATGGAGACGGAGACATCTGCGC
CT
GGAGAACAACCAAAATTTCTGGGAGTAAGGGAACAACGAGTCACTGGAACCCTTGTGTTTATTCTGAC
T
GGCCTGTCAGTCTTCATGGCTCCCATCCTGAAGTTTATCCCGATGCCTGTGCTGTATGGTGTGTTCCTG
TAT
ATGGGGGTGGCCTCACTTAACGGTGTGCAGTTCATGGACCGTCTCAAGCTGCTGCTGATGCCCTTGA
AG
CATCAGCCCGACTTCATCTACCTGCGCCACGTCCCCCTCCGCCGAGTCCACCTGTTCACCTTCCTGCA
G
GTGTTGTGCCTGGCTCTGCTCTGGATCCTCAAGTCAACAGTGGCTGCAATTATTTTTCCTGTTATGATC
CTG
GCCCTGGTAGCAGTCAGAAAAGGTATGGATTACCTCTTCTCCCAGCACGACCTCAGCTTCCTTGATG
AT
GTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGACGAGAAGAAAAAGAAAAAGAAGAAAGGAAGTTT
G
GATAGCGACAATGACGATGAGAAAGATCCTCAACATTCCTCGAACGCCACACATCATGCTGATAAAATT
CCT
TTCCTTGAGTCGCTGGGTTTACCCAGTCCTCCAAGAACTCCAGTGAAAGTCGTGCCTCAAATTAGAA
TC
GAACGTGAGCCTGAAGACAACGATTATCTTTGGAGGAGCAAGGGAACAGAAACCACGTTGTAA


Translation (1094 aa):
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKAGHKEKKEKERISENYSDKSDV
E
NADESSSSILKPL
ISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQ
G
GERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLV
EMIADHQIETGLLKPDLKDKVTYTLLR
K
HRHQTKKSNLRSLADIGKTVSSASRMFSNPDN
GSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPR
D
AEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPT
RFLFILLGPKGKAKSYHEIGRAIATLMSD
E
VFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
H
DGGHGGGGHGDCEELQRTG
RFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGL
L
GDATDNMQ
GVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLW
S
AFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACL
P
PDP
VNLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILF
L
GTYTSSMAMKKFKTSRYFPTT
ARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFV
P
PFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLK
KGAGYHLDLFWVAILMVVCSFMALPW
Y
VAATVISIAHIDSLKMETETSAPGEQPKFLGV
REQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFL
Y
MGVASLNGVQ
FMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMI
L
ALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDD
EKDPQHSSNATHHADKI
P
FLESLGLP
SPPRTPVKVVPQIRIEREPEDNDYLWRSKGTETTL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser