NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51516.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51516.1 Public Mus musculus 5 Tec 16 104 75 CCDS HistoryNCBI Gene:21682Re-query CCDS DB by CCDS ID:51516.1Re-query CCDS DB by GeneID:21682

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51516.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000071944 ENSMUSP00000071836 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071944Link to Ensembl Protein Viewer:ENSMUSP00000071836Re-query CCDS DB by Nucleotide ID:ENSMUST00000071944Re-query CCDS DB by Protein ID:ENSMUSP00000071836
Original member Current member EBI,WTSI ENSMUST00000113594 ENSMUSP00000109224 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113594Link to Ensembl Protein Viewer:ENSMUSP00000109224Re-query CCDS DB by Nucleotide ID:ENSMUST00000113594Re-query CCDS DB by Protein ID:ENSMUSP00000109224
Original member Current member EBI,WTSI OTTMUST00000061564 OTTMUSP00000030213 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000061564Link to Vega Protein Viewer:OTTMUSP00000030213Re-query CCDS DB by Nucleotide ID:OTTMUST00000061564Re-query CCDS DB by Protein ID:OTTMUSP00000030213
Original member Current member EBI,WTSI OTTMUST00000061565 OTTMUSP00000030214 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000061565Link to Vega Protein Viewer:OTTMUSP00000030214Re-query CCDS DB by Nucleotide ID:OTTMUST00000061565Re-query CCDS DB by Protein ID:OTTMUSP00000030214
Original member Current member NCBI NM_001113460.2 NP_001106931.1 Accepted alive Link to Nucleotide Sequence:NM_001113460.2Link to Protein Sequence:NP_001106931.1Re-query CCDS DB by Nucleotide ID:NM_001113460Re-query CCDS DB by Protein ID:NP_001106931Link to BLink:NP_001106931.1
Original member Current member NCBI NM_001113464.2 NP_001106935.1 Accepted alive Link to Nucleotide Sequence:NM_001113464.2Link to Protein Sequence:NP_001106935.1Re-query CCDS DB by Nucleotide ID:NM_001113464Re-query CCDS DB by Protein ID:NP_001106935Link to BLink:NP_001106935.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001106931.1 630 P24604-1 630 99.2064% 0 5
NP_001106935.1 630 P24604-1 630 99.2064% 0 5

Chromosomal Locations for CCDS 51516.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 72756296 72756379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72757363 72757520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72757604 72757722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72760343 72760407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72763564 72763780 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72764124 72764295 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72765512 72765586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72768705 72768838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72771147 72771226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72773831 72773885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72779421 72779486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72782003 72782175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72783718 72783758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72785917 72786045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72786738 72786819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72789140 72789244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 72823456 72823593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1893 nt):
ATGAATTTCAACACTATCCTAGAAGAGATTCTTATTAAAAGGTCCCAGCAGAAAAAGAAGACATCACCCT
TA
AACTACAAAGAGAGACTTTTTGTACTTACAAAATCCGTGTTGAGCTACTATGAGGGTCGAGCGGAGAA
G
AAATACAGAAAGGGCGTCATTGATATTTCCAAAATCAAGTGTGTGGAGATAGTGAAGAACGATGATGGT
GTC
ATTCCCTGTCAAAATAAATTTCCATTCCAGGTTGTTCATGATGCTAATACACTTTATATTTTTGCAC
CT
AGTCCACAAAGCAGGGACCGATGGGTGAAGAAGTTAAAAGAAGAAATAAAGAACAACAATAATATCAT
G
ATTAAATACCATCCTAAATTCTGGGCAGATGGGAGTTACCAGTGTTGTAGACAAACAGAAAAACTAGCA
CCC
GGATGTGAGAAGTACAATCTTTTTGAGAGTAGTATAAGAAAGACCCTGCCTCCCGCGCCAGAAATAA
AG
AAGAGAAGGCCTCCTCCACCAATTCCCCCAGAGGAAGAAAATACTGAAGAAATCGTTGTAGCGATGTA
T
GACTTCCAAGCGACGGAAGCACATGACCTCAGGTTAGAGAGAGGCCAAGAGTATATCATCCTGGAAAAG
AAT
GACCTCCATTGGTGGAGAGCGAGAGATAAGTATGGGAGTGAAGGATATATCCCAAGTAATTACGTCA
CA
GGGAAGAAATCCAACAACTTAGATCAATATGAGTGGTACTGCAGAAATACCAACAGAAGCAAAGCAGA
A
CAGCTCCTCAGAACGGAAGATAAAGAAGGTGGTTTTATGGTGAGAGACTCCAGTCAACCAGGCTTGTAC
ACT
GTCTCCCTTTACACAAAGTTTGGGGGAGAAGGCTCATCAGGTTTCAGGCATTATCACATAAAGGAAA
CA
GCAACATCCCCAAAGAAGTATTACCTGGCAGAGAAGCATGCTTTCGGGTCCATTCCTGAGATCATTGA
A
TATCACAAGCACAATGCGGCAGGGCTTGTCACCAGGCTGCGGTACCCGGTCAGTACAAAGGGGAAGAAC
GCT
CCCACTACTGCCGGCTTCAGCTATGATAAGTGGGAGATTAACCCATCAGAGCTGACCTTTATGAGAG
AG
TTGGGGAGCGGACTGTTTGGAGTGGTGAGGCTTGGCAAGTGGCGGGCCCAGTACAAAGTGGCCATCAA
A
GCTATCCGGGAAGGCGCCATGTGTGAAGAGGATTTCATAGAGGAAGCTAAAGTCATGATGAAGCTGACA
CAC
CCCAAGCTGGTACAGCTCTATGGTGTATGCACCCAGCAGAAGCCCATCTACATCGTTACCGAGTTCA
TG
GAACGGGGCTGCCTTCTGAATTTCCTCCGGCAGAGACAAGGCCATTTCAGCAGAGACATGCTGCTAAG
C
ATGTGTCAAGATGTCTGTGAAGGGATGGAGTACCTGGAGAGAAACAGCTTCATCCACAGAGACCTGGCT
GCC
AGAAATTGTCTAGTGAATGAAGCAGGAGTTGTCAAAGTATCTGATTTTGGAATGGCCAGGTACGTTC
TG
GATGATCAGTACACAAGTTCTTCTGGCGCCAAGTTCCCTGTGAAGTGGTGTCCCCCAGAAGTGTTTAA
T
TACAGCCGCTTTAGCAGCAAGTCAGACGTCTGGTCGTTTGGTGTGCTAATGTGGGAAATATTCACAGAA
GGC
AGGATGCCCTTTGAGAAGAACACCAATTACGAAGTGGTAACCATGGTGACTCGTGGCCACCGCCTCC
AC
CGGCCAAAGCTGGCTTCCAAATATTTGTATGAGGTGATGCTGAGATGCTGGCAAGAGAGACCAGAGGG
A
AGGCCTTCCTTTGAAGACTTGCTGCGTACGATAGATGAACTAGTTGAATGTGAAGAAACTTTTGGAAGA
TGA


Translation (630 aa):
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYRKGVIDISKIKCVEIVKNDDG
V
IPCQNKFPFQ
VVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKYHPKFWADGSYQCCRQTEKLA
P
GCEKYNLFES
SIRKTLPPAPEIKKRRPPPPIPPEEENTEEIVVAMYDFQATEAHDLRLERGQEYIILEK
N
DLHWWRARDKY
GSEGYIPSNYVTGKKSNNLDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSSQPGLY
T
VSLYTKFG
GEGSSGFRHYHIKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKN
A
PTTAGFSY
DKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLT
H
PKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDMLLSMCQDVCEGMEYLERNSFIHRDL
A
A
RNCLVNEAGVVKVSDFGMA
RYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTE
G
RMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRCWQE
RPEGRPSFEDLLRTIDELVECEETFGR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser