NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51309.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51309.1 Public Mus musculus 4 Bai2 16 104 75 CCDS HistoryNCBI Gene:230775Re-query CCDS DB by CCDS ID:51309.1Re-query CCDS DB by GeneID:230775

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51309.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000106017 ENSMUSP00000101638 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106017Link to Ensembl Protein Viewer:ENSMUSP00000101638Re-query CCDS DB by Nucleotide ID:ENSMUST00000106017Re-query CCDS DB by Protein ID:ENSMUSP00000101638
Original member Current member EBI,WTSI OTTMUST00000021773 OTTMUSP00000009933 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000021773Link to Vega Protein Viewer:OTTMUSP00000009933Re-query CCDS DB by Nucleotide ID:OTTMUST00000021773Re-query CCDS DB by Protein ID:OTTMUSP00000009933
Original member Current member NCBI NM_173071.3 NP_775094.2 Accepted alive Link to Nucleotide Sequence:NM_173071.3Link to Protein Sequence:NP_775094.2Re-query CCDS DB by Nucleotide ID:NM_173071Re-query CCDS DB by Protein ID:NP_775094Link to BLink:NP_775094.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_775094.2 1549 Q8CGM1-3 1549 100% 0 0

Chromosomal Locations for CCDS 51309.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 129992069 129992879 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130005025 130005108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130005390 130005554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130006752 130006916 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130007562 130007726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130007810 130007977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130008072 130008173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130008323 130008429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130009211 130009405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130009482 130009550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130009654 130009762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130010058 130010394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130011313 130011418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130011602 130011645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130011825 130011951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130012276 130012379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130012474 130012576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130013493 130013643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130013822 130013891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130014323 130014389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130014551 130014636 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130016634 130016696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130017062 130017233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130017529 130017624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130017915 130017954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130018661 130019280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130021219 130021254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130021563 130021661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130022150 130022338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4650 nt):
ATGACCCCAGCCTGTCCCCTCTTACTGTCTGTGATTCTGTCCCTGCGCCTGGCCACGGCCTTCGACCCTG
CC
CCCAGTGCCTGCTCTGCCCTGGCCTCGGGCGTGCTCTACGGGGCCTTCTCGCTGCAGGACCTCTTTCC
C
ACCATCGCCTCGGGCTGCTCCTGGACCCTGGAGAACCCAGACCCCACCAAGTACTCCCTCTACCTGCGC
TTC
AACCGGCAGGAGCAGGTTTGCACACACTTTGCCCCGCGCCTGCTGCCCCTGGACCACTACCTGGTCA
AC
TTTACCTGCCTGCGGCCTGGTCCAGAGGAAGCCACAGCCCGGGCTGAGTCGGAGGTGGGACGGCCAGA
G
GAGGAGGAGGAGGAGGCGGCGGCAGCAGCATCAGGGTTGGAGTTGTGTGGTGGCTCAGGCCCCTTTACC
TTT
CTGCACTTCGACAAGAACTTTGTGCAGCTGTGCCTGTCGGCTGAGCCCTCTGAGGCCCCTCGTCTGC
TA
GCGCCTGCTGCCCTGGCCTTCCGTTTTGTGGAGGTCTTGCTGATCAACAACAACAACTCCAGCCAGTT
C
ACCTGTGGTGTGCTCTGCCGCTGGAGTGAGGAGTGTGGCCGGGCTGCAGGCAGGGCTTGTGGCTTTGCA
CAG
CCAGGGTGTAGTTGTCCTGGGGAGGCAGGGGCCAACCCCGCCACCACCACATCTCCGGGGCCTCCGG
TT
GCCCACACCCTGTCCAATGCCCTGGTGCCCGGGGGCCCAGCCCCTCCTGCTGAGGCCGACTTGCACTC
G
GGGAGCAGCAATGACCTGTTCACCACCGAGATGAGATATGGTGAGGAGCCGGAAGAGGAACCGAAGGTG
AAA
ACCCAGTGGCCAAGGTCTGCAGATGAGCCTGGGCTATACATGGCGCAGACAGGCGACCCAGCAGCTG
AG
GAGTGGTCCCCGTGGAGCGTGTGTTCCCTGACGTGTGGGCAGGGTCTGCAGGTGCGGACCCGCTCCTG
C
GTGTCCTCCCCCTATGGGACCCTGTGCAGCGGGCCCCTTCGGGAGACCCGGCCTTGCAACAATTCAGCC
ACC
TGCCCAGTGCACGGCGTGTGGGAGGAGTGGGGGTCCTGGAGCCTGTGCTCCCGCAGCTGCGGGCGGG
GG
TCTCGGAGCCGGATGCGGACCTGCGTGCCCCCCCAGCACGGCGGCAAGGCCTGCGAGGGTCCCGAGCT
G
CAGACTAAACTCTGCAGTATGGCCGCCTGCCCGGTGGAAGGCCAGTGGCTAGAATGGGGTCCCTGGGGC
CCA
TGCTCATCATCTTGTGCCAATGGGACCCAGCAGCGCAGCCGGAAATGCAGTGTGGCGGGTCCAGCCT
GG
GCCACGTGCGCAGGTGCCCTCACGGATACCCGTGAGTGCAGCAATCTCGATTGCCCGGCCACTGACGG
C
AAGTGGGGGCCGTGGAACGCGTGGAGCCTGTGCTCCAAGACGTGTGACACGGGCTGGCAACGCCGCTTC
CGC
ATGTGCCAGGCTTCTGGCACACAGGGCTACCCTTGCGAGGGCACAGGAGAGGAGGTGAAACCCTGCA
GT
GAGAAGAGGTGTCCAGCCTTCCATGAGATGTGCAGGGATGAGTACGTGATGTTGATGACATGGAAGAG
G
GCGGCAGCTGGCGAGATCATTTACAACAAGTGTCCCCCTAATGCCTCGGGTTCTGCTAGCCGCCGCTGT
CTC
CTCAGTGCCCAGGGCGTAGCATACTGGGGACTGCCCAGCTTTGCTCGTTGCATATCCCATGAATACC
GC
TACCTGTACCTGTCACTTCGGGAACACCTGGCTAAGGGCCAGCGCATGCTGGCAGGTGAGGGCATGTC
A
CAGGTGGTGCGGAGCCTGCAGGAGCTACTGGCACGGCGCACTTACTACAGCGGGGACCTGCTCTTCTCT
GTG
GACATCCTAAGGAACGTCACTGACACCTTCAAGAGGGCCACCTATGTCCCTTCCGCCGATGACGTGC
AG
CGTTTCTTCCAGGTGGTGAGCTTCATGGTGGATTCAGAAAACAAGGACAAATGGGATGATGCTCAGCA
G
GTGTCACCGGGCTCTGTGCACCTGCTGCGTGTTGTGGAAGATTTCATTCACCTCGTGGGCGACGCTCTC
AAG
GCCTTCCAGAGCTCTCTCATTGTCACGGACAATCTGGTGATCAGCATTCAGAGAGAGCCTATCTCCG
CC
GTGTCCAGTGACATCACGTTTCCCATGCGGGGCCGCAGGGGCATGAAGGACTGGGTGCGACACTCAGA
G
GATCGTCTCTTTCTACCCAAGGAGGTGCTCAGCCTGTCCTCCCCAGGAAAGCCAGCCACACCTGGGGCA
GCC
ACAGCAGGCAGCCCGGGCAGGGGGAGGGGCCCAGGAACGGTGCCCCCTGGCCCAGGCCACGCCCACC
AG
CGCCTTCTCCCAGCTGACCCCGAAGAGTCCTCCTCCTACTTTGTGATCGGTGCTGTGCTCTACCGCAC
C
CTTGGCCTCATCCTGCCGCCCCCCAGGCCTCCACTTGCTGTCACCTCCCGGGTGATGACAGTGACTGTG
CGT
CCCCCCACCCAGCCTCCAGCTGAGCCCCTCATTACAGTGGAACTCTCGTACATCATCAATGGCACCA
CC
GATCCCCACTGTGCCAGCTGGGACTACTCCAGAGCAGATACCAACTCGGGGGACTGGAACACTGAGAG
C
TGCCAGACCTTGGAGACCCAGGCGGCTCACACCCGCTGCCAGTGCCAGCACCTGTCCACCTTTGCCGTC
CTG
GCCCAGCCACCCAAGGACCTGACCCTGGAGCTGGCAGGTGCTCCCTCTGTCCCCCTGGTGATCGGCT
GT
GCAGTGTCCTGCATGGCTCTGCTCACCCTGCTGGCCATCTATGCAGCCTTCTGGAGGTTTATAAAATC
A
GAACGCTCCATCATCTTGCTGAACTTCTGCCTGTCCATCCTGGCTTCCAACATTCTGATCCTGGTGGGC
CAG
TCCCGGGTGCTGAGCAAGGGCGTATGCACCATGACGGCTGCCTTCCTACACTTCTTCTTTCTGTCCT
CC
TTTTGCTGGGTGCTTACAGAGGCCTGGCAATCCTATCTGGCTGTCATCGGGCGGATGCGCACCCGCCT
G
GTTCGCAAGCGCTTCCTCTGCCTGGGCTGGGGTCTACCTGCCCTGGTGGTGGCTGTGTCTGTTGGCTTT
ACT
CGCACCAAAGGATATGGTACATCCAGCTACTGCTGGCTGTCCCTAGAGGGCGGCCTGCTCTATGCCT
TC
GTGGGTCCAGCAGCAGTCATTGTCCTGGTGAACATGCTCATCGGGATTATCGTCTTCAACAAGCTCAT
G
GCTCGCGATGGCGTCTCAGACAAATCTAAGAAGCAGAGGGCTGGCCGACTGTCTTGGAATCTCTGGGGA
TAT
GGCTCTCAACTGTGTCTTTTTCCAAAGCTTCCAAGGGCTTCACTCTGGAGTTCCTGCGTGGTACTGC
CT
CTCCTGGCGCTTACCTGGATGTCTGCCGTCCTGGCCATGACAGATCGCCGCTCCGTCCTCTTCCAGGC
A
CTCTTTGCCGTTTTCAACTCTGCACAAGGCTTTGTCATCACCGCTGTGCACTGCTTCCTGCGCCGAGAG
GTC
CAGGATGTGGTAAAGTGTCAGATGGGTGTGTGTCGGGCTGATGAGAGTGAAGACTCCCCAGACTCGT
GC
AAGAACGGGCAGCTGCAGATCCTGTCAGACTTTGAAAAGGACGTGGATCTGGCTTGTCAGACAGTTCT
G
TTCAAGGAGGTCAACACCTGCAACCCGTCCACCATTACCGGCACTCTGTCCCGCCTGTCTCTGGATGAG
GAT
GAGGAGCCCAAGTCCTGTCTCGTGGGTCCTGAGGGTGGCCTCAGCTTCTCACCACTGCCTGGGAACA
TC
CTGGTACCCATGGCAGCCTCACCAGGTCTAGGGGAGCCACCACCACCCCAGGAGACCAACCCTGTGTA
C
ATGTGTGGGGAGGGTGGCCTGCGGCAGTTGGACCTTACATGGATACGGCAGAGTGAACCAGGCTCTGAG
GGG
GACTACATGGTTCTGCCCCGGCGGACTTTGAGCCTGCAGCCTGGTGGTGGGGGTACAGCGGGTGAGG
AG
GCCCCAAGGGCCCGGCCTGAGGGGACCCCCCGGCGGGCTGCCAAAACGGTAGCCCACACTGAAGGCTA
C
CCCAGCTTCCTGTCTGTGGAGCACTCGGGTCTAGGGCTGGGCCCTGCCTATGGGTCTCTCCAGAACCCG
TAT
GGAATGACCTTCCAACCACCACCACCAACACCCAGCGCCCGCCAAGTACCAGAGCCAGGAGAACGTA
GC
CGGACCATGCCCCGTACAGTGCCTGGTTCCACCATGAAGCTGGGCTCCCTTGAGCGAAAGAAGCTTCG
G
TATTCGGACTTGGACTTTGAGAAGGTGATGCACACTCGGAAACGGCACTCGGAACTCTACCACGAACTC
AAC
CAGAAGTTCCACACTTTCGACCGCTACCGTAGCCAGTCCTCAGCCAAGGAGAAACCCAGCCCCCCCG
GG
GGACGCCCTGGCTTGTCCCAGCACAGGAGGCATCAAAGCTGGAGCACCTTCAAATCTATGACACTGGG
C
TCACTGCCCCCCAAGCCCCGAGAACGGCTGGCCCTGCACCGGACAGCAGCCTGGGAGCCCACAGAACCG
CCA
GACGGCGACTTCCAGACAGAGGTGTGA


Translation (1549 aa):
MTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLR
F
NRQEQVCTHFAPRLLPLDHYLVNFTCLRPGPEEATARAESEVGRPEEEEEEAAAAASGLELCGGSGPFT
F
LHFDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFA
Q
PGCSCPGEAGANPATTTSPGPPVAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRY
GEEPEEEPKV
K
TQWPRSADEPGLYMAQT
GDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLRETRPCNNSA
T
CP
VHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEGQWLEWGPWG
P
CSSSCANGTQQRSRKCSVAGPAWATCAGALTDTRECSNLDCP
ATDGKWGPWNAWSLCSKTCDTGWQRRF
R
MCQASGTQGYPCEGTGEEVKPCSEKRCP
AFHEMCRDEYVMLMTWKRAAAGEIIYNKCPPNASGSASRRC
L
LSAQGVAYWGLPSFARCISHEYRYLYLS
LREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFS
V
DILRNVTDTFKRATYVPSADDVQ
RFFQVVSFMVDSENKDKWDDAQQVSPGSVHLLRVVEDFIHLVGDAL
K
AFQSSLIVTDNL
VISIQREPISAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATPGA
A
TAGSPGRGRGPGTVPPGPGHAHQRLLPADPEESSSYFVIGAVLYRTLGLILPPP
RPPLAVTSRVMTVTV
R
PPTQPPAEPLITVELSYIIN
GTTDPHCASWDYSRADTNSGDWNTESCQTLETQAAHTRCQCQHLSTFAV
L
AQPPKDL
TLELAGAPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASNILILVG
Q
SRVLSK
GVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSVGF
T
RTKGYGTSS
YCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGVSDKSKKQRAGRLSWNLWG
Y
GSQLCLFPKLP
RASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITAVHCFLRRE
V
QDVVKCQMGVCRADESEDSPDSCKNGQLQIL
SDFEKDVDLACQTVLFKEVNTCNPSTITGTLSRLSLDE
D
EEPKSCLVGPEGGLSFSPLPGNILVPMAASPGLGEPPPPQETNPVYMCGEGGLRQLDLTWIRQSEPGSE
G
DYMVLPRRTLSLQPGGGGTAGEEAPRARPEGTPRRAAKTVAHTEGYPSFLSVEHSGLGLGPAYGSLQNP
Y
GMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLE
RKKLRYSDLDFEKVMHTRKRHSELYHEL
N
QKFHTFDRYRSQSSAK
EKPSPPGGRPGLSQHRRHQSWSTFKSMTLGSLPPKPRERLALHRTAAWEPTEP
P
DGDFQTEV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser