NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51284.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51284.1 Public Mus musculus 4 Mpl 16 104 75 CCDS HistoryNCBI Gene:17480Re-query CCDS DB by CCDS ID:51284.1Re-query CCDS DB by GeneID:17480See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51284.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000168404 ENSMUSP00000130167 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168404Link to Ensembl Protein Viewer:ENSMUSP00000130167Re-query CCDS DB by Nucleotide ID:ENSMUST00000168404Re-query CCDS DB by Protein ID:ENSMUSP00000130167
Original member Current member NCBI NM_001122949.2 NP_001116421.1 Accepted alive Link to Nucleotide Sequence:NM_001122949.2Link to Protein Sequence:NP_001116421.1Re-query CCDS DB by Nucleotide ID:NM_001122949Re-query CCDS DB by Protein ID:NP_001116421Link to BLink:NP_001116421.1

Chromosomal Locations for CCDS 51284.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 118443429 118443680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118444017 118444104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118446052 118446148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118446355 118446514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118448546 118448688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118448881 118449062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118454459 118454585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118455118 118455280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118455645 118455943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118456676 118456854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118457108 118457240 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 118457393 118457471 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1902 nt):
ATGCCCTCTTGGGCCCTCTTCATGGTCACCTCCTGCCTCCTCTTGGCCCTTCCAAACCAGGCACAAGTCA
CC
AGCCAAGATGTCTTCTTGCTGGCCTTGGGCACAGAGCCCCTGAACTGCTTCTCCCAAACATTTGAGGA
C
CTCACCTGCTTCTGGGATGAGGAAGAGGCAGCACCCAGTGGGACATACCAGCTGCTGTATGCCTACCGA
GG
A
GAGAAGCCCCGTGCATGCCCCCTGTATTCCCAGAGTGTGCCCACCTTTGGAACCCGGTATGTGTGCC
AG
TTTCCAGCCCAGGATGAAGTGCGCCTCTTCTTTCCGCTGCACCTCTGGGTGAAGAATGTGTCCCTCAA
C
CAGACTTTGATCCAGCGGGTGCTGTTTGTGGATAGTGTGGGCCTGCCAGCTCCCCCCAGGGTCATCAAG
GCC
AGGGGTGGGAGCCAACCAGGGGAACTTCAGATCCACTGGGAGGCCCCTGCTCCTGAAATCAGTGACT
TC
CTGAGGCATGAACTCCGCTATGGCCCCACGGACTCCAGCAACGCCACTGCCCCCTCCGTCATTCAGCT
G
CTCTCCACAGAAACCTGCTGCCCCACTTTGTGGATGCCGAACCCAGTCCCTGTTCTTGACCAGCCTCCG
TGT
GTTCATCCGACAGCATCCCAACCGCATGGACCAGTGAGGACCTCCCCAGCTGGAGAAGCTCCATTTC
TG
ACAGTGAAGGGTGGAAGCTGTCTCGTCTCAGGCCTCCAGGCTGGCAAATCCTACTGGCTCCAGCTACG
C
AGCCAACCCGACGGGGTCTCCCTTCGTGGCTCCTGGGGACCCTGGTCCTTCCCTGTGACTGTGGATCTT
CCA
GGAGATGCAGTGACAATTGGACTTCAGTGCTTTACCTTGGATCTGAAGATGGTCACCTGCCAGTGGC
AG
CAACAAGACCGCACTAGCTCCCAAGGCTTCTTCCGCCACAGCAGGACGAGGTGCTGCCCCACAGACAG
G
GACCCCACCTGGGAGAAATGTGAAGAGGAGGAACCGCGTCCAGGATCACAGCCCGCTCTCGTCTCCCGC
TGC
CACTTCAAGTCACGAAATGACAGTGTTATTCACATCCTTGTAGAGGTGACCACAGCGCAAGGTGCCG
TT
CACAGCTACCTGGGCTCCCCTTTTTGGATCCACCAGGCTGTGCTCCTTCCCACCCCGAGCCTGCACTG
G
AGGGAGGTCTCAAGTGGAAGGCTGGAGTTGGAGTGGCAGCACCAGTCATCTTGGGCAGCTCAAGAGACC
TGC
TACCAGCTCCGGTACACGGGAGAAGGCCGTGAGGACTGGAAGGTGCTGGAGCCATCTCTCGGTGCCC
GG
GGAGGGACCCTAGAGCTGCGCCCCCGAGCTCGCTACAGCTTGCAGCTGCGTGCCAGGCTCAACGGCCC
C
ACCTACCAAGGTCCCTGGAGCGCCTGGTCTCCCCCAGCTAGGGTGTCCACGGGCTCCGAGACTGCTTGG
ATC
ACCTTGGTGACTGCTCTGCTCCTGGTGCTGAGCCTCAGTGCCCTTCTGGGCCTACTGCTGCTAAAGT
GG
CAATTTCCTGCGCACTACAGGAGACTGAGGCATGCTTTGTGGCCCTCGCTTCCAGACCTACACCGGGT
C
CTAGGCCAGTACCTCAGAGACACTGCAGCCCTAAGTCCTTCTAAGGCCACGGTTACCGATAGCTGTGAA
GAA
GTGGAACCCAGCCTCCTGGAAATCCTCCCTAAGTCCTCAGAGAGCACTCCTTTACCTCTGTGTCCCT
CC
CAACCTCAGATGGACTACAGAGGACTGCAACCTTGCCTGCGGACCATGCCCCTGTCTGTGTGTCCACC
C
ATGGCTGAGACGGGGTCCTGCTGCACCACACACATTGCCAACCACTCCTACCTACCACTAAGCTATTGG
CAG
CAGCCCTGA


Translation (633 aa):
MPSWALFMVTSCLLLALPNQAQVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSGTYQLLYAYR
G
EKPRACPLYSQSVPTFGTRYVCQFPAQDEVRLFFPLHLWVKNVSLNQTLIQRVLFVDSVGLPAPPRVIK
A
RGGSQPGELQIHWEAPAPEISDFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLWMPNPVPVLDQPP
C
VHPTASQPHGPVRTSPAGE
APFLTVKGGSCLVSGLQAGKSYWLQLRSQPDGVSLRGSWGPWSFPVTVDL
P
GDA
VTIGLQCFTLDLKMVTCQWQQQDRTSSQGFFRHSRTRCCPTDRDPTWEKCEEEEPRPGSQPALVSR
C
HFKSRNDSVIHILVEVTTAQGAVHSYLGSPFWIHQA
VLLPTPSLHWREVSSGRLELEWQHQSSWAAQET
C
YQLRYTGEGREDWK
VLEPSLGARGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETAW
I
TLVTALLLVLSLSALLGLLLLKWQFPAHY
RRLRHALWPSLPDLHRVLGQYLRDTAALSPSKATVTDSCE
E
VEPSLLEILPKSSESTPLPLCPSQPQMDYRGLQPCLRTMPLSVCPPMAETGSCCTTHIANHSYLPLSYW
Q
QP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser