NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51240.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51240.1 Public Mus musculus 4 Lepr 19 105 81 CCDS HistoryNCBI Gene:16847Re-query CCDS DB by CCDS ID:51240.1Re-query CCDS DB by GeneID:16847See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51240.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000037552 ENSMUSP00000037385 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037552Link to Ensembl Protein Viewer:ENSMUSP00000037385Re-query CCDS DB by Nucleotide ID:ENSMUST00000037552Re-query CCDS DB by Protein ID:ENSMUSP00000037385
Original member Current member EBI,WTSI OTTMUST00000019183 OTTMUSP00000008794 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000019183Link to Vega Protein Viewer:OTTMUSP00000008794Re-query CCDS DB by Nucleotide ID:OTTMUST00000019183Re-query CCDS DB by Protein ID:OTTMUSP00000008794
Original member Current member NCBI NM_146146.2 NP_666258.2 Accepted alive Link to Nucleotide Sequence:NM_146146.2Link to Protein Sequence:NP_666258.2Re-query CCDS DB by Nucleotide ID:NM_146146Re-query CCDS DB by Protein ID:NP_666258Link to BLink:NP_666258.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_666258.2 1162 P48356-1 1162 100% 0 0

Chromosomal Locations for CCDS 51240.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 101728030 101728069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101733267 101733596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101735560 101735683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101745511 101745716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101750287 101750429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101752061 101752205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101764861 101765151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101765304 101765421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101768047 101768246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101771297 101771445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101772836 101772995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101774201 101774283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101779905 101780121 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101782545 101782727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101789263 101789358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101790801 101790906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101791995 101792070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 101814448 101815269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3489 nt):
ATGATGTGTCAGAAATTCTATGTGGTTTTGTTACACTGGGAATTTCTTTATGTGATAGCTGCACTTAACC
TG
GCATATCCAATCTCTCCCTGGAAATTTAAGTTGTTTTGTGGACCACCGAACACAACCGATGACTCCTT
T
CTCTCACCTGCTGGAGCCCCAAACAATGCCTCGGCTTTGAAGGGGGCTTCTGAAGCAATTGTTGAAGCT
AAA
TTTAATTCAAGTGGTATCTACGTTCCTGAGTTATCCAAAACAGTCTTCCACTGTTGCTTTGGGAATG
AG
CAAGGTCAAAACTGCTCTGCACTCACAGACAACACTGAAGGGAAGACACTGGCTTCAGTAGTGAAGGC
T
TCAGTTTTTCGCCAGCTAGGTGTAAACTGGGACATAGAGTGCTGGATGAAAGGGGACTTGACATTATTC
ATC
TGTCATATGGAGCCATTACCTAAGAACCCCTTCAAGAATTATGACTCTAAGGTCCATCTTTTATATG
AT
CTGCCTGAAGTCATAGATGATTCGCCTCTGCCCCCACTGAAAGACAGCTTTCAGACTGTCCAATGCAA
C
TGCAGTCTTCGGGGATGTGAATGTCATGTGCCGGTACCCAGAGCCAAACTCAACTACGCTCTTCTGATG
TAT
TTGGAAATCACATCTGCCGGTGTGAGTTTTCAGTCACCTCTGATGTCACTGCAGCCCATGCTTGTTG
TG
AAACCCGATCCACCCTTAGGTTTGCATATGGAAGTCACAGATGATGGTAATTTAAAGATTTCTTGGGA
C
AGCCAAACAATGGCACCATTTCCGCTTCAATATCAGGTGAAATATTTAGAGAATTCTACAATTGTAAGA
GAG
GCTGCTGAAATTGTCTCAGCTACATCTCTGCTGGTAGACAGTGTGCTTCCTGGATCTTCATATGAGG
TC
CAGGTGAGGAGCAAGAGACTGGATGGTTCAGGAGTCTGGAGTGACTGGAGTTCACCTCAAGTCTTTAC
C
ACACAAGATGTTGTGTATTTTCCACCCAAAATTCTGACTAGTGTTGGATCGAATGCTTCTTTTCATTGC
ATC
TACAAAAACGAAAACCAGATTATCTCCTCAAAACAGATAGTTTGGTGGAGGAATCTAGCTGAGAAAA
TC
CCTGAGATACAGTACAGCATTGTGAGTGACCGAGTTAGCAAAGTTACCTTCTCCAACCTGAAAGCCAC
C
AGACCTCGAGGGAAGTTTACCTATGACGCAGTGTACTGCTGCAATGAGCAGGCGTGCCATCACCGCTAT
GCT
GAATTATACGTGATCGATGTCAATATCAATATATCATGTGAAACTGACGGGTACTTAACTAAAATGA
CT
TGCAGATGGTCACCCAGCACAATCCAATCACTAGTGGGAAGCACTGTGCAGCTGAGGTATCACAGGCG
C
AGCCTGTATTGTCCTGATAGTCCATCTATTCATCCTACGTCTGAGCCCAAAAACTGCGTCTTACAGAGA
GAC
GGCTTTTATGAATGTGTTTTCCAGCCAATCTTTCTATTATCTGGCTATACAATGTGGATCAGGATCA
AC
CATTCTTTAGGTTCACTTGACTCGCCACCAACGTGTGTCCTTCCTGACTCCGTAGTAAAACCACTACC
T
CCATCTAACGTAAAAGCAGAGATTACTGTAAACACTGGATTATTGAAAGTATCTTGGGAAAAGCCAGTC
TTT
CCGGAGAATAACCTTCAATTCCAGATTCGATATGGCTTAAGTGGAAAAGAAATACAATGGAAGACAC
AT
GAGGTATTCGATGCAAAGTCAAAGTCTGCCAGCCTGCTGGTGTCAGACCTCTGTGCAGTCTATGTGGT
C
CAGGTTCGCTGCCGGCGGTTGGATGGACTAGGATATTGGAGTAATTGGAGCAGTCCAGCCTATACGCTT
GTC
ATGGATGTAAAAGTTCCTATGAGAGGGCCTGAATTTTGGAGAAAAATGGATGGGGACGTTACTAAAA
AG
GAGAGAAATGTCACCTTGCTTTGGAAGCCCCTGACGAAAAATGACTCACTGTGTAGTGTGAGGAGGTA
C
GTGGTGAAGCATCGTACTGCCCACAATGGGACGTGGTCAGAAGATGTGGGAAATCGGACCAATCTCACT
TTC
CTGTGGACAGAACCAGCGCACACTGTTACAGTTCTGGCTGTCAATTCCCTCGGCGCTTCCCTTGTGA
AT
TTTAACCTTACCTTCTCATGGCCCATGAGTAAAGTGAGTGCTGTGGAGTCACTCAGTGCTTATCCCCT
G
AGCAGCAGCTGTGTCATCCTTTCCTGGACACTGTCACCTGATGATTATAGTCTGTTATATCTGGTTATT
GAA
TGGAAGATCCTTAATGAAGATGATGGAATGAAGTGGCTTAGAATTCCCTCGAATGTTAAAAAGTTTT
AT
ATCCACGATAATTTTATTCCCATCGAGAAATATCAGTTTAGTCTTTACCCAGTATTTATGGAAGGAGT
T
GGAAAACCAAAGATAATTAATGGTTTCACCAAAGATGCTATCGACAAGCAGCAGAATGACGCAGGGCTG
TAT
GTCATTGTACCCATAATTATTTCCTCTTGTGTCCTACTGCTCGGAACACTGTTAATTTCACACCAGA
G
A
ATGAAAAAGTTGTTTTGGGACGATGTTCCAAACCCCAAGAATTGTTCCTGGGCACAAGGACTGAATTT
C
CAAAAGCCTGAAACATTTGAGCATCTTTTTACCAAGCATGCAGAATCAGTGATATTTGGTCCTCTTCTT
CTG
GAGCCTGAACCCATTTCAGAAGAAATCAGTGTCGATACAGCTTGGAAAAATAAAGATGAGATGGTCC
CA
GCAGCTATGGTCTCCCTTCTTTTGACCACACCAGACCCTGAAAGCAGTTCTATTTGTATTAGTGACCA
G
TGTAACAGTGCTAACTTCTCTGGGTCTCAGAGCACCCAGGTAACCTGTGAGGATGAGTGTCAGAGACAA
CCC
TCAGTTAAATATGCAACTCTGGTCAGCAACGATAAACTAGTGGAAACTGATGAAGAGCAAGGGTTTA
TC
CATAGTCCTGTCAGCAACTGCATCTCCAGTAATCATTCCCCACTGAGGCAGTCTTTCTCTAGCAGCTC
C
TGGGAGACAGAGGCCCAGACATTTTTCCTTTTATCAGACCAGCAACCCACCATGATTTCACCACAACTT
TCA
TTCTCGGGGTTGGATGAGCTTTTGGAACTGGAGGGAAGTTTTCCTGAAGAAAATCACAGGGAGAAGT
CT
GTCTGTTATCTAGGAGTCACCTCCGTCAACAGAAGAGAGAGTGGTGTGCTTTTGACTGGTGAGGCAGG
A
ATCCTGTGCACATTCCCAGCCCAGTGTCTGTTCAGTGACATCAGGATCCTCCAGGAGAGATGCTCACAC
TTT
GTAGAAAATAATTTGAGTTTAGGGACCTCTGGTGAGAACTTTGTACCTTACATGCCCCAATTTCAAA
CC
TGTTCCACGCACAGTCACAAGATAATGGAGAATAAGATGTGTGACTTAACTGTGTAA


Translation (1162 aa):
MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDDSFLSPAGAPNNASALKGASEAIVEA
K
FNSSGIYVPELSKTVFHCCFGNEQGQNCSALTDNTEGKTLASVVKASVFRQL
GVNWDIECWMKGDLTLF
I
CHMEPLPKNPFKNYDSKVHLLYD
LPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLM
Y
LEITSAGVSFQSPLMSLQPMLV
VKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVR
E
AAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILTSVGSNASFHC
I
YKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRPRGKFTYDAVYCCNEQACHHRY
A
ELYVI
DVNINISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQR
D
GFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSV
VKPLPPSNVKAEITVNTGLLKVSWEKPV
F
PENNLQFQIRYGLSGKEIQWK
THEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTL
V
MDVK
VPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVGNRTNLT
F
LWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSK
VSAVESLSAYPLSSSCVILSWTLSPDDYSLLYLVI
E
WKILNEDDGMKWLRIPSNVKKFYIH
DNFIPIEKYQFSLYPVFMEGVGKPKIINGFTKDAIDKQQNDAGL
Y
VIVPIIISSCVLLLGTLLISHQ
RMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKHAESVIFGPLL
L
EPEPISEEISVDTAWKNKDEMVPAAMVSLLLTTPDPESSSICISDQCNSANFSGSQSTQVTCEDECQRQ
P
SVKYATLVSNDKLVETDEEQGFIHSPVSNCISSNHSPLRQSFSSSSWETEAQTFFLLSDQQPTMISPQL
S
FSGLDELLELEGSFPEENHREKSVCYLGVTSVNRRESGVLLTGEAGILCTFPAQCLFSDIRILQERCSH
F
VENNLSLGTSGENFVPYMPQFQTCSTHSHKIMENKMCDLTV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser