NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51044.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51044.1 Public Mus musculus 3 Csf1 16 104 75 CCDS HistoryNCBI Gene:12977Re-query CCDS DB by CCDS ID:51044.1Re-query CCDS DB by GeneID:12977See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51044.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000118593 ENSMUSP00000113136 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118593Link to Ensembl Protein Viewer:ENSMUSP00000113136Re-query CCDS DB by Nucleotide ID:ENSMUST00000118593Re-query CCDS DB by Protein ID:ENSMUSP00000113136
Original member Current member EBI,WTSI OTTMUST00000065742 OTTMUSP00000032804 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065742Link to Vega Protein Viewer:OTTMUSP00000032804Re-query CCDS DB by Nucleotide ID:OTTMUST00000065742Re-query CCDS DB by Protein ID:OTTMUSP00000032804
Original member Current member NCBI NM_001113529.1 NP_001107001.1 Accepted alive Link to Nucleotide Sequence:NM_001113529.1Link to Protein Sequence:NP_001107001.1Re-query CCDS DB by Nucleotide ID:NM_001113529Re-query CCDS DB by Protein ID:NP_001107001Link to BLink:NP_001107001.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001107001.1 257 P07141-2 257 100% 0 0

Chromosomal Locations for CCDS 51044.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 107746739 107746784 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107747107 107747159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107748154 107748284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107750311 107750458 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107753732 107753902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107755431 107755493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107756617 107756739 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107760025 107760063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (774 nt):
ATGACCGCGCGGGGCGCCGCGGGGCGCTGCCCTTCTTCGACATGGCTGGGCTCCCGGCTGCTGCTGGTCT
GT
CTCCTCATGAGCAGGAGTATTGCCAAGGAGGTGTCAGAACACTGTAGCCACATGATTGGGAATGGACA
C
CTGAAGGTCCTGCAGCAGTTGATCGACAGTCAAATGGAGACTTCATGCCAGATTGCCTTTGAATTTGTA
GAC
CAGGAACAGCTGGATGATCCTGTTTGCTACCTAAAGAAGGCCTTTTTTCTGGTACAAGACATAATAG
AT
GAGACCATGCGCTTTAAAGACAACACCCCCAATGCTAACGCCACCGAGAGGCTCCAGGAACTCTCCAA
T
AACCTGAACAGCTGCTTCACCAAGGACTATGAGGAGCAGAACAAGGCCTGTGTCCGAACTTTCCATGAG
ACT
CCTCTCCAGCTGCTGGAGAAGATCAAGAACTTCTTTAATGAAACAAAGAATCTCCTTGAAAAGGACT
GG
AACATTTTTACCAAGAACTGCAACAACAGCTTTGCTAAGTGCTCTAGCCGAGGCCATGTGGAGCAGCA
T
GAGGGATCCTCTGACCCCCAGATCCCTGAGTCTGTCTTCCACCTGCTGGTGCCGGGCATCATCCTAGTC
TTG
CTGACTGTTGGGGGCCTCCTGTTCTACAAGTGGAAGTGGAGGAGCCATCGAGACCCTCAGACATTGG
AT
TCTTCTGTGGGGCGACCAGAGGACAGCTCCCTGACCCAGGATGAGGACAGACAGGTGGAACTGCCAGT
A
TAG


Translation (257 aa):
MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFV
D
QEQL
DDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHE
T
PLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSR
GHVEQHEGSSDPQIPESVFHLLVPGIILV
L
LTVGGLLFYKWKWR
SHRDPQTLDSSVGRPEDSSLTQDEDRQVELPV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser