NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50596.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50596.1 Public Mus musculus 2 Scn3a 16 104 75 CCDS HistoryNCBI Gene:20269Re-query CCDS DB by CCDS ID:50596.1Re-query CCDS DB by GeneID:20269

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 50596.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000100069 ENSMUSP00000097647 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000100069Link to Ensembl Protein Viewer:ENSMUSP00000097647Re-query CCDS DB by Nucleotide ID:ENSMUST00000100069Re-query CCDS DB by Protein ID:ENSMUSP00000097647
Original member Current member EBI,WTSI OTTMUST00000030910 OTTMUSP00000013849 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000030910Link to Vega Protein Viewer:OTTMUSP00000013849Re-query CCDS DB by Nucleotide ID:OTTMUST00000030910Re-query CCDS DB by Protein ID:OTTMUSP00000013849
Original member Current member NCBI NM_018732.3 NP_061202.3 Accepted alive Link to Nucleotide Sequence:NM_018732.3Link to Protein Sequence:NP_061202.3Re-query CCDS DB by Nucleotide ID:NM_018732Re-query CCDS DB by Protein ID:NP_061202Link to BLink:NP_061202.3

Chromosomal Locations for CCDS 50596.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 65460557 65461737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65464715 65464985 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65466922 65467026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65468067 65468204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65469012 65469065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65469926 65470198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65472279 65472401 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65482151 65482324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65483043 65483197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65484346 65484466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65494923 65495396 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65497370 65497726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65498867 65499040 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65506017 65506255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65507147 65507279 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65508462 65508662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65514472 65514762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65520823 65521029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65521792 65521933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65524146 65524209 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65524604 65524876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65525695 65525786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65526497 65526625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65529390 65529479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65530804 65530922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 65536413 65536676 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5844 nt):
ATGGCCCAGGCACTGCTGGTACCCCCGGGACCTGAGAGCTTCCGCCTTTTCACTCGAGAATCTCTTGCTG
CT
ATCGAAAAGCGTGCTGCAGAAGAGAAAGCCAAGAAACCCAAGAAAGAACAAGACATTGACGATGAGAA
C
AAGCCAAAGCCAAACAGTGACTTGGAAGCTGGGAAGAACCTTCCATTTATCTATGGAGACATTCCTCCA
GAG
ATGGTGTCGGAGCCTCTGGAGGACCTGGACCCCTACTACGTCAGTAAGAAAACTTTTGTAGTGTTGA
AT
AAAGGGAAGGCAATTTTTCGATTCAGTGCCACCTCCGCCTTGTATATTTTAACTCCACTAAACCCCGT
T
AGGAAAATTGCTATTAAGATTTTGGTACACTCTTTATTCAGCATGCTTATCATGTGCACTATTTTGACC
AAC
TGTGTATTTATGACATTGAGCAATCCTCCTGACTGGACGAAGAATGTAGAGTACACATTCACTGGGA
TC
TATACCTTTGAGTCACTTATAAAGATCTTGGCCAGAGGATTCTGCTTAGAAGATTTCACATTTCTTCG
T
GACCCATGGAACTGGCTGGATTTCAGTGTCATCGTGATGGCATATGTGACAGAGTTTGTGGACCTGGGC
AAT
GTCTCAGCGCTGAGAACGTTCAGAGTTCTCCGAGCATTGAAAACAATATCAGTCATTCCAGGTTTAA
AG
ACCATCGTGGGGGCCCTGATCCAGTCGGTGAAGAAGCTGTCTGACGTCATGATACTCACTGTGTTCTG
T
CTGAGCGTCTTTGCTCTCATCGGGCTGCAGCTCTTCATGGGCAACCTGAGGAATAAATGCTTGCAGTGG
CCT
CCAAGCGATTCTGCTTTTGAGATCAACACTACTTCCTACTTCAATGGCACAATGGACTCAAATGGGA
CA
TTTGTTAATGTAACAATGAGCACATTCAACTGGAAGGACTATATCGCAGATGACAGCCACTTTTATGT
T
TTGGATGGACAAAAAGATCCTTTACTTTGTGGAAATGGGTCCGATGCAGGACAATGTCCAGAAGGGTAC
ATC
TGTGTGAAGGCTGGACGAAACCCCAACTACGGTTACACGAGCTTTGACACATTTAGCTGGGCCTTCT
TA
TCGCTGTTTCGACTCATGACTCAAGACTACTGGGAGAACCTTTACCAGTTGACATTACGTGCAGCTGG
G
AAAACCTACATGATCTTTTTCGTCCTGGTAATTTTCTTGGGCTCATTTTATTTGGTGAACTTGATCCTG
GCT
GTGGTGGCCATGGCCTATGAGGAACAAAATCAGGCCACACTGGAGGAGGCTGAGCAGAAAGAGGCGG
AG
TTTCAGCAGATGTTGGAGCAGTTGAAAAAGCAGCAAGAGGAGGCTCAGGCGGTGGCAGCTGCCTCAGC
A
GCGTCCAGAGACTTCAGTGGGATAGGAGGGTTAGGAGAACTTCTGGAGAGTTCTTCAGAAGCTTCCAAG
TTG
AGCTCCAAGAGTGCCAAGGAGTGGAGGAATCGGAGGAAGAAGAGGAGACAGAGGGAGCACTTGGAGG
GA
AACCACAGACCCGAAGGAGACAGGTTTCCCAAGTCGGAATCAGAAGACAGCGTCAAGCGAAGGAGTTT
C
CTGTTCTCCCTGGATGGGAACCCGCTGAGCGGCGACAAGAAGCTGTGCTCTCCCCATCAGTCTCTCTTG
AGT
ATCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACGAGCATTTTCAGCTTCAGAGGTCGGG
CG
AAGGACGTGGGGTCTGAGAATGACTTTGCGGATGATGAACACAGCACCTTTGAAGATAGCGAGAGCAG
G
AGAGACTCACTGTTTGTGCCGCACAGACCTGGAGAGCGACGCAACAGTAACGGTACCACCACTGAAACA
GAA
GTCAGGAAGAGAAGGCTAAGTTCTTACCAGATCTCGATGGAAATGCTGGAGGATTCCTCTGGGAGAC
AA
AGAGCCATGAGCATAGCCAGTATCCTGACCAACACGATGGAGGAACTTGAAGAATCTAGACAGAAGTG
T
CCACCATGCTGGTATAGATTTGCCAATGTGTTTTTGATCTGGGACTGTTGTGATTCATGGTTGAAAGTA
AAG
CATCTTGTGAATTTGATTGTGATGGATCCATTTGTTGACCTGGCCATCACCATCTGCATCGTGTTAA
AC
ACACTGTTCATGGCCATGGAGCACTACCCGATGACGGAGCAGTTCAGCAGTGTGCTGACGGTGGGAAA
C
CTGGTCTTCACCGGGATCTTCACAGCCGAGATGGTCCTGAAAATCATCGCAATGGATCCCTATTACTAT
TTC
CAAGAGGGCTGGAATATCTTTGATGGAATTATTGTTAGCCTGAGTTTAATGGAGCTTGGCCTGGCAA
AC
GTGGAGGGGCTGTCCGTGCTTCGGTCCTTCAGACTGCTGCGAGTCTTCAAGTTGGCAAAATCCTGGCC
C
ACACTGAATATGCTCATTAAGATCATCGGCAACTCGGTGGGCGCACTGGGCAACCTGACCCTGGTGCTG
GCC
ATCATCGTCTTCATTTTTGCCGTGGTCGGCATGCAGCTGTTTGGAAAGAGCTACAAGGAGTGTGTTT
GC
AAGATCAATGAGGACTGCAAGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTGATAGT
G
TTCCGCGTGCTGTGTGGGGAGTGGATAGAGACCATGTGGGACTGCATGGAGGTCGCGGGCCAGACCATG
TGC
CTTATTGTGTTTATGTTGGTCATGGTGATTGGGAACCTTGTGGTTCTGAACCTCTTCCTGGCCTTAT
TG
TTGAGTTCCTTTAGTTCAGACAACCTTGCTGCTACGGACGATGATAACGAAATGAACAACCTCCAGAT
C
GCGGTGGGAAGGATGCAAAAGGGGATTGATTATGTGAAAAATAAGATACGGGAGTGCTTCCGAAAAGCG
TTT
TTTAGAAAGCCGAAAGTGATAGAAATCCACGAAGGGAACAAAATAGACAGCTGCATGTCCAATAACA
CG
GGCGTAGTTGAAATAAGCAAAGAGCTTAACTACCTTAAAGACGGTAACGGAACCACCAGTGGCGTGGG
T
ACTGGAAGCAGTGTGGAGAAATACGTAATTGATGAAAATGACTACATGTCATTCATCAACAACCCCAGC
CTC
ACCGTGACGGTGCCAATTGCCGTGGGAGAGTCTGACTTTGAAAATTTAAACACGGAAGAGTTTAGCA
GT
GAGTCAGAACTGGAAGAAAGCAAGGAGAAATTAAATGCAACCAGCTCTTCTGAAGGAAGCACAGTTGA
C
GTTGCTCCGCCCCGAGAAGGTGAACAAGCTGAAATTGAACCTGAGGAGGACCTTAAGCCAGAAGCTTGC
TTT
ACTGAAGGATGCATTAAAAAATTTCCCTTCTGCCAAGTAAGTACGGAAGAAGGTAAAGGAAAAATCT
GG
TGGAATCTTAGGAAGACCTGCTATAGCATTGTGGAACACAACTGGTTTGAGACGTTCATTGTGTTCAT
G
ATTCTCCTCAGTAGTGGTGCTTTGGCCTTTGAAGATATATACATTGAGCAACGGAAGACCATCAAAACC
ATG
CTGGAGTATGCTGACAAAGTCTTCACTTACATCTTCATCCTGGAAATGCTCCTCAAATGGGTGGCCT
AT
GGATTTCAAACCTATTTCACCAATGCCTGGTGCTGGTTGGACTTCTTGATTGTTGATGTTTCTTTGGT
T
AGCCTGGTGGCCAACGCTCTTGGCTATTCAGAACTTGGTGCCATCAAATCCCTACGGACCCTGAGAGCT
CTG
AGGCCGCTCCGAGCCTTATCCCGCTTTGAAGGCATGAGGGTGGTTGTGAACGCTCTTGTTGGTGCAA
TC
CCCTCCATCATGAATGTGCTACTGGTGTGCCTCATCTTCTGGTTAATCTTTAGTATCATGGGTGTGAA
T
CTGTTTGCTGGAAAGTTCTATCACTGTGTTAACATGACAACGGGCAGCATGTTCGACATGAGTGAAGTC
AAC
AATTTCAGCGACTGTCAGGCTCTTGGCAAGCAAGCCCGATGGAAGAATGTGAAAGTCAACTTTGACA
AT
GTTGGGGCTGGCTACCTGGCATTGCTGCAAGTGGCCACATTCAAAGGCTGGATGGATATTATGTATGC
A
GCTGTGGATTCACGGGACGTCAAACTGCAGCCTGTATATGAAGAAAATCTGTACATGTATCTGTACTTT
GTC
ATCTTCATCATCTTTGGGTCGTTCTTCACTCTAAATCTATTCATCGGCGTCATCATAGACAACTTCA
AC
CAGCAGAAGAAGAAGTTTGGAGGTCAAGACATCTTTATGACAGAAGAGCAGAAAAAGTACTACAATGC
A
ATGAAGAAACTTGGCTCCAAAAAACCTCAGAAGCCCATCCCTCGACCTGCAAACAAATTTCAAGGAATG
GTC
TTTGACTTTGTAACCAGACAAGTGTTTGACATCAGCATCATGATCCTCATCTGCCTCAACATGGTGA
CC
ATGATGGTGGAAACGGACGACCAGAGCAAATACATGACCCTGGTTTTGTCCCGAATCAACCTGGTATT
C
ATCGTCCTCTTCACTGGGGAGTTTCTGCTGAAGCTCATCTCTCTCAGATACTACTACTTCACGATTGGC
TGG
AACATCTTTGACTTTGTGGTGGTGATTCTCTCAATTGTAGGAATGTTCCTTGCTGAGCTGATAGAGA
AG
TATTTTGTGTCTCCTACCCTGTTCCGAGTCATCCGCCTGGCCAGGATTGGACGAATCCTACGCCTGAT
C
AAAGGCGCCAAGGGGATCCGCACGCTGCTCTTTGCTCTGATGATGTCCCTTCCTGCGCTGTTCAACATC
GGC
CTCCTGCTTTTCCTCGTCATGTTCATCTACGCCATCTTTGGGATGTCCAACTTTGCCTATGTTAAAA
AA
GAGGCTGGAATTGATGACATGTTCAACTTTGAGACTTTTGGCAACAGCATGATCTGCCTGTTCCAAAT
C
ACCACCTCTGCGGGCTGGGATGGACTGTTGGCCCCCATCCTCAACAGTGCACCTCCTGACTGTGACCCT
GAT
GCAATTCACCCTGGAAGCTCAGTGAAGGGAGACTGTGGGAACCCATCTGTGGGGATTTTCTTTTTTG
TC
AGCTACATCATCATATCCTTCCTGGTTGTGGTGAACATGTACATTGCTGTCATCCTGGAGAACTTCAG
C
GTTGCCACAGAAGAAAGTGCAGAGCCCCTGAGTGAGGACGACTTTGAGATGTTCTACGAGGTCTGGGAG
AAG
TTCGACCCTGACGCCACCCAGTTCATAGAGTTCTGCAAGCTCTCTGACTTTGCAGCTGCCCTGGATC
CT
CCCCTCCTCATCGCAAAGCCAAACAAAGTCCAGCTCATTGCCATGGACCTGCCCATGGTGAGTGGAGA
C
CGCATCCACTGCCTGGACATCTTATTTGCTTTTACAAAGCGGGTCCTGGGTGAGAGTGGAGAGATGGAT
GCC
CTTCGAATCCAGATGGAAGATCGGTTCATGGCTTCCAATCCCTCCAAGGTCTCTTATGAGCCCATTA
CC
ACCACTCTGAAGCGCAAACAAGAGGAGGTGTCTGCTGCTATCATTCAGCGTAATTACAGATGTTATCT
T
TTAAAGCAAAGGTTAAAAAACATATCAAATACGTATGACAAAGAGACAATCAAGGGGAGGATTGTCTTG
CCT
ATAAAAGGAGATATGGTTATTGACAAATTAAATGGGAATTCCACCCCAGAAAAGACAGATGGGAGTT
CC
TCTACCACCTCTCCTCCTTCCTATGACAGTGTAACAAAACCAGATAAGGAAAAGTTTGAGAAAGACAA
A
CCAGAAAAAGAAAGCAAAGGGAAAGAGGTCTGA


Translation (1947 aa):
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDDENKPKPNSDLEAGKNLPFIYGDIPP
E
MVSEPLEDLDPYYVSKK
TFVVLNKGKAIFRFSATSALYILTPLNPVRKIAIKILVHSLFSMLIMCTILT
N
CVFMTLSNPPDWTKNV
EYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFSVIVMAYVTEFVDLG
N
VSALRTFRVLRALKTISVIP
GLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQW
P
PSDSAFEINTTSYFNGTMDSNGTFVNVTMSTFNWKDYIADD
SHFYVLDGQKDPLLCGNGSDAGQCPEGY
I
CVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQL
TLRAAGKTYMIFFVLVIFLGSFYLVNLIL
A
VVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQ
AVAAASAASRDFSGIGGLGELLESSSEASK
L
SSKSAKEWRNRRKKRRQREHLEGNHRPEGDRFPKSESEDSVKRRSFLFSLDGNPLSGDKKLCSPHQ
SLL
S
IRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHSTFEDSESRRDSLFVPHRPGERRNSN
GTTTET
E
VRKRRLSSYQISMEMLEDSSGRQRAMSIASILTNTME
ELEESRQKCPPCWYRFANVFLIWDCCDSWLKV
K
HLVNLIVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLTVGNL
VFTGIFTAEMVLKIIAMDPYYY
F
QEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRL
LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
A
IIVFIFAVVGMQLFGKSYKECVCKINEDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTM
C
LIVFMLVMVIGNLV
VLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKNKIRECFRKA
F
FRKPKVIEIHEGNKIDSCMSNNTGVVEISKELNYLKDGNGTTSGVGTGSSVEKYVIDENDYMSFINNPS
L
TVTVPIAVGESDFENLNTEEFSSESELEESKE
KLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEAC
F
TE
GCIKKFPFCQVSTEEGKGKIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKT
M
LEYADKVFTYIFILEMLLKWVAYGFQTYFTNAWCWLDFLIVD
VSLVSLVANALGYSELGAIKSLRTLRA
L
RPLRALSRFEGMR
VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGSMFDMSEV
N
NFSDCQALGKQARWKNVKVNFDNVGAGYLALLQV
ATFKGWMDIMYAAVDSRDVKLQPVYEENLYMYLYF
V
IFIIFGSFFTLNLFIGVIIDNFNQQKKK
FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGM
V
FDFVTRQVFDISIMILICLNMVTMMVETDDQSKYMTLVLSRINLVFIVLFTGEFLLKLISLRYYYFTIG
W
NIFDFVVVILSIV
GMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNI
G
LLLFLVMFIYAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDP
D
AIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWE
K
FDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMD
A
LRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNYRCYLLKQRLKNISNTYDKETIKGRIVL
P
IKGDMVIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEKFEKDKPEKESKGKEV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser