NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49886.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49886.1 Public Mus musculus 16 Robo2 16 104 75 CCDS HistoryNCBI Gene:268902Re-query CCDS DB by CCDS ID:49886.1Re-query CCDS DB by GeneID:268902See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49886.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000117785 ENSMUSP00000112776 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000117785Link to Ensembl Protein Viewer:ENSMUSP00000112776Re-query CCDS DB by Nucleotide ID:ENSMUST00000117785Re-query CCDS DB by Protein ID:ENSMUSP00000112776
Original member Current member EBI,WTSI OTTMUST00000041283 OTTMUSP00000018523 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041283Link to Vega Protein Viewer:OTTMUSP00000018523Re-query CCDS DB by Nucleotide ID:OTTMUST00000041283Re-query CCDS DB by Protein ID:OTTMUSP00000018523
Original member Current member NCBI NM_175549.4 NP_780758.3 Accepted alive Link to Nucleotide Sequence:NM_175549.4Link to Protein Sequence:NP_780758.3Re-query CCDS DB by Nucleotide ID:NM_175549Re-query CCDS DB by Protein ID:NP_780758Link to BLink:NP_780758.3

Chromosomal Locations for CCDS 49886.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 73895826 73895830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73897016 73897207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73898912 73899184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73904383 73904556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73916098 73916303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73920534 73920794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73928024 73928177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73933046 73933171 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73933587 73933868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73938731 73938858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73940256 73940298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73948203 73948385 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73956488 73956659 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73958304 73958428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73961679 73961910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73967768 73967889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73971054 73971220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73973153 73973315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73973705 73973786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73978408 73978613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73981981 73982152 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 73985588 73985712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 74015871 74015998 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 74034985 74035123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 74045822 74045942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 74046780 74046937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 74352551 74352877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 74410852 74410912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4527 nt):
ATGAATCCTCTGATGTTTACACTATTATTGCTCTTTGGATTTCTCTGCATTCAGATTGATGGATCTCGTC
TT
CGTCAAGAAGACTTTCCCCCCAGGATCGTAGAACACCCTTCTGATGTCATCGTCTCCAAGGGAGAGCC
C
ACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGGATGGTGAGAGG
GTG
GAGACAGACAAGGATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGC
GA
ATTGTTCATGGGCGCAGAAGTAAACCGGACGAAGGGAGTTACGTTTGTGTTGCAAGGAACTATCTTGG
T
GAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCATTATTGCGAGATGACTTCCGGCAAAACCCCACA
GAT
GTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAA
CC
ATCTACTGGAAAAAGGACAAAGTCCGAATTGATGACAAGGAAGAGAGAATAAGTATCCGTGGTGGGAA
G
CTGATGATCTCTAATACTAGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATGGTGGGA
GAA
AGGGACAGCGACCCTGCAGAGCTCACTGTCTTTGAACGACCCACATTTCTCAGGAGGCCAATTAACC
AG
GTGGTGCTAGAGGAAGAAGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAG
G
TGGAAAAAAGATGATGCAGACTTGCCGAGAGGAAGGTATGATATCAAAGATGACTACACGCTGAGAATT
AAA
AAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGGTGGGAAAAGTGGAAG
CC
TCTGCTACCCTCACTGTCCGAGCTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCA
A
GGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAA
GGC
AGCCAGAACCTACTTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGG
GG
GACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCCTAACCGTGGC
A
GGAAGCATTTTAGCTAAAGCACAGTTGGAAGTTACTGACGTTTTGACAGATAGACCTCCACCCATAATC
TTG
CAAGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAAAGCCACTGGTG
AG
CCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGGGAGAGATCCAAGAGCCACGAT
C
CAAGACCAAGGAACACTGCAGATTAAGAATTTACGGATATCTGATACTGGCACTTATACTTGTGTGGCT
ACA
AGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACAGAATCTGGAGCAACAATCAGTA
AA
AATTATGATATGAATGACCTCCCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAG
T
GTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCTTTC
AG
C
CAATCGGTGAGCAATAGCTGGCAGACAGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGG
GG
CTGAGGCCCAACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATCCAAG
T
CCTATGTCGGATCCTGTACGCACACAAGATATCAGCCCCCCAGCACAAGGAGTGGACCACAGACAGGTG
CAG
AAGGAATTAGGTGATGTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAG
TC
ACATGGACGGTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGTACCGTCAGACTTCGGG
A
CTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTG
AAT
TTGAAAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACA
GT
GAATCGAAAACAGTCCGAACCACTGAGGAAGCCCCAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGAC
A
GTTGGAAGTCACAACAGCACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGA
ATT
ATTCAGGAATATAAGATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAACGGTGGATG
CA
GCCATTCGCTCTGTAGTAATAGGTGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAG
C
ACAAGTGCAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTGGGGGACGTAACGAAGTTGTC
ATT
ACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAGCAACCGGCATTTATAGCTG
GC
ATTGGTGGTGCCTGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAG
A
AAGGGACTCAGCAATTATGCTGTAACATTTCAAAGAGGAGATGGAGGACTAATGAGCAATGGGAGCCGT
CCA
GGTCTTCTAAATGCTGGCGATCCCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGC
CA
GTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAGATGTGCTGCCTCCGGT
G
CCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACT
ACC
AAAACCACTTACAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAATCCTGC
AT
TCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTCAGTTCAACAGAA
G
ACAGACCTCATGGGATTTGGTTATTCGCTACCTGATCAGAACAAGGGGAACAACGCCTTACTTTACATC
CCT
GACTACCGATTGGCTGAGGGATTGTCTAATAGAATGCCACACAACCAGTCACAGGATTTCAGCACCA
CC
AGCTCTCACAACAGCTCAGAAAGGAGTGGCAGTCTCTCAGGTGGGAAAGGTGGAAAAAAGAAGAAAAC
T
AAAAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGGGCTAATGTCCCTCTACCTCCTCCTCCC
GTC
CAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGGCTATGACAGTGACA
GC
TGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGA
A
GATCGGGTCCCAACACCTCCTGTTCGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCC
ACT
GCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGATGAGTTGA
CA
AGGGCCTATCAGTTTGATATAGCAAAACAAACATGGCACATTCAAAGCAATACCCCACCTCCACAACC
C
CCAGCTCCGCCATTAGGTTACGTGTCCGGAGCCTTGATTTCTGATTTGGAGACAGATGTTCCAGATGAG
GAT
GCTGATGATGAAGAGGAACCATTAGAAATTCCCAGGCCCCTCAGAGCACTAGACCAGACACCTGGAT
CC
AGTATGGACAATCTAGACAGCTCTGTCACAGGAAAAGCCTTTAGCTCCTCTCAAAGGCAGCGGCCCAC
C
AGCCCATTTTCTACGGACAGTAACACCAGTGCTGCCCAGAATCAAAGCCAGAGGCCTCGGCCCACGAAA
AAA
CATAAGGGAGGACGGATGGACCCACAGCCAGTGTTACCTCATCGGAGGGAAGGGATGCCAGATGATC
TT
CCCCCACCACCAGATCCCCCACCAGGTCAGGGTTTAAGGCAGCAGATAGGCCTGAGCCAACACTCTGG
T
AACGTGGAAAACTCAACAGAGAGAAAAGGAAGCTCTCTAGAGAGACAACAAGCAGCCAACTTAGAAGAC
ACA
AAGAGCTCATTGGATTGTCCAGCTAAAACTGTTCTAGAGTGGCAGCGTCAAACCCAGGACTGGATAA
AC
TCTACAGAACGCCAAGAAGAAACTCGGAAAGCCCCACACAAACAAGGGGTTGGATCAGAGGAGTCCCT
G
GTGCCCTACAGCAAGCCCAGCTTCCCGTCTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTAAA
GGG
TCCACTGGCCCTCGGAAGGCTGACGTGCTGAGAGGCAGCCACCAGAGGAATGCCAATGACCTTCTCG
AC
ATTGGATATGTGGGCTCAAATAGTCAAGGACAGTTTACAGAGTAA


Translation (1508 aa):
MNPLMFTLLLLFGFLCIQIDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGER
V
ETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVA
LLRDDFRQNPT
D
VVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS
IRGGKLMISNTRKSDAGMYTCVGTNMVG
E
RDSDPAELTVF
ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRI
K
KAMSTDEGTYVCIAENRVGKVEASATLTVR
APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKE
G
SQ
NLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII
L
QGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR
ISDTGTYTCVA
T
SSSGETSWSAVLDVT
ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAF
S
QSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQV
Q
KELGDVVVRLHNPVVLTPTTVQVTWT
VDRQPQFIQGYRVMYRQTSGLQASTVWQNLDAKVPTERSAVLV
N
LKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEE
APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNG
I
IQEYK
IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGGRNEVV
I
TENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYA
VTFQRGDGGLMSNGSR
P
GLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRG
DVLPPVPGQGDKTATMLSDGAIYSSIDFT
T
KTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNN
ALLYI
P
DYRLAEGLSNRMPHNQSQDFSTTSSHNSSERSGSLS
GGKGGKKKKTKNSSKAQKNNGSTWANVPLPPPP
V
QPLPGTELGHYAAEQEN
GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQS
T
ATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQT
WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPDE
D
ADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVT
GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTK
K
HKGGRMDPQPVLPHRREGMPD
DLPPPPDPPPGQGLRQQIGLSQHSGNVENSTERKGSSLERQQAANLED
T
KSSLDCPAKTVLEWQRQTQDWINSTERQEETRKAPHKQGVGS
EESLVPYSKPSFPSPGGHSSSGTSSSK
G
STGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFT
E



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser