NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49869.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49869.1 Public Mus musculus 16 Nfkbiz 16 104 75 CCDS HistoryNCBI Gene:80859Re-query CCDS DB by CCDS ID:49869.1Re-query CCDS DB by GeneID:80859See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49869.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000096026 ENSMUSP00000093726 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000096026Link to Ensembl Protein Viewer:ENSMUSP00000093726Re-query CCDS DB by Nucleotide ID:ENSMUST00000096026Re-query CCDS DB by Protein ID:ENSMUSP00000093726
Original member Current member EBI,WTSI ENSMUST00000114457 ENSMUSP00000110101 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114457Link to Ensembl Protein Viewer:ENSMUSP00000110101Re-query CCDS DB by Nucleotide ID:ENSMUST00000114457Re-query CCDS DB by Protein ID:ENSMUSP00000110101
Original member Current member EBI,WTSI OTTMUST00000047637 OTTMUSP00000021592 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000047637Link to Vega Protein Viewer:OTTMUSP00000021592Re-query CCDS DB by Nucleotide ID:OTTMUST00000047637Re-query CCDS DB by Protein ID:OTTMUSP00000021592
Original member Current member NCBI NM_001159395.1 NP_001152867.1 Accepted alive Link to Nucleotide Sequence:NM_001159395.1Link to Protein Sequence:NP_001152867.1Re-query CCDS DB by Nucleotide ID:NM_001159395Re-query CCDS DB by Protein ID:NP_001152867Link to BLink:NP_001152867.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001152867.1 629 Q9EST8-2 629 100% 0 0

Chromosomal Locations for CCDS 49869.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 55812730 55812783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55813950 55814117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55814241 55814351 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55815640 55815809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55816068 55816131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55816317 55816463 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55816831 55816936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55817729 55818534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55818748 55818851 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55818992 55819022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 55819567 55819695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1890 nt):
ATGGGGGTTGGCAGGCAGCAGAGAGGCCCCTTTCAAGGTGTTCGCGTGAAGAACTCGGTGAAGGAGCTCC
TG
CTACACATCCGAAGCAACAAGCAGAAGGCTTCCGGCCAGCCCGTGGATGAGTTTAAGACACAGAGTGT
G
AACATTGAGCAGCTGACAGACCTGAAGAGTGCAGTGTCCGCAGTGGGGAAAAGAAAGGGACCCGATCCT
CTG
TCCGATGGACCGGTTTGCAAGAGGCCAGCTCTGTTGCCTTCTCACTTCGTGACATCACCGCAAACGC
CT
ACACCTGGGGAGAGCATGGAAGATGTTCGCCACAGCGAATCCAAGCTGGATAGCAGCGCTGCCCTGCT
T
CAGAATATTATAAACATCAAGAATGAGTGCAACCCAGTTTCACTAAACACTGTTCAGGTTAGCTGGATG
AGC
CCCACGGTTCCCCAGAACTCGCCAAGAGACCAGTGCCAGGATTTCCATGGAGGCCAGGCCTTCTCTC
CA
CCTCAGAAATACCAACCGTTCCAAGTCAGTGGCTCTCCACAGATGATGGACCAGGCGTCAATGTACCA
G
TATTCGCCACAAACACAGAACATGCAGCAGCCGCCGCCGCTGCCACCACAGCAGCAACATCAACAGAAT
TAT
CCCCACAACTCACCCCTGCAGTTCAGTCCTTACTCCAGAATGTCCCAGTCTCCCAAGTATGATTCCA
AC
CTCTTTGATACTCACGAGCCACAGTTCTGCACGGGCCAAAGTTTTGTGTCTTTACTGACTGGCCCGGG
G
GAACCCGAGTCTCTTGCTGTTCCCGTTCCGGCTCCCACCAGCATTCCACCCCAAACTGAGACTCAGCTG
CAG
ACCTTCAGCCTGATGCCAAGCAATGCCTGCGAGGCCGTCGTCGGGGTGCACGATGTGGGCTCGCACT
CT
TTGGGCACGTCCCTGTCACTCCAGAACATCATGGGAAGCCCGATGAATACCACCCAGCTGGGGAAGTC
A
TTTTTTCAGTGGCAGGTAGAGCAGGAAGAAAGCAAATTGGCAAATATTCCCCAGGACCAGTTCCTCGCT
AGG
GACGGAGATGGTGACACGTTTCTCCATATTGCTGTTGCCCAAGGGAGGCGAGCGCTCTCGTATGTCC
TT
GCAAGAAAGATGAACGCTCTTCACATGCTGGACATTAAGGAGCACAATGGACAGAGTGCCTTTCAGGT
G
GCGGTAGCTGCCAATCAGCACCTCATTGTGCAAGATCTGGTAAACCTTGGTGCCCAGGTGAACACCACG
GAT
TGCTGGGGAAGGACACCTCTGCATGTCTGTGCGGAGAAGGGCCACTCCCAGGTGCTCCAGGCCATCC
AG
AAGGGAGCTGTGAGGAGCAATCAGTTTGTGGATCTTGAGGCAACGAACTATGATGGCCTGACTCCCCT
A
CATTGCGCGGTCGTGGCTCACAATGCGGTGGTGCACGAACTGCAGAGGAATCGGCAGTCTCATTCGCCC
GAA
GTGCAGGACCTCTTACTAAGGAATAAGAGCCTGGTAGACACCATTAAGTGTCTGATTCAGATGGGAG
CC
GCAGTGGAGGCAAAGGATCGTAAGAGTGGCCGCACAGCCCTGCACTTGGCAGCGGAAGAAGCAAATCT
G
GAACTCATTCGCCTCTTTTTGGAGTTGCCCAGTTGCCTGTCTTTCGTGAATGCCAAGGCTTACAATGGA
AAC
ACCGCCCTCCATGTTGCTGCCAGCCTGCAGTATCGGGTGACACAGTTGGACGCAGTCCGCCTGTTGA
TG
AGGAAGGGAGCTGACCCCAGTACTCGGAACTTGGAGAATGAACAGCCCGTGCATTTGGTCCCCGATGG
C
CCAGTGGGAGAACAGATCCGACGTATCCTGAAGGGGAAGTCCATTCAGCAGCGAGCACCACCATACTAG


Translation (629 aa):
MGVGRQQRGPFQGVRVKNSVKELLLHIRSNKQKASGQPVDEFKTQSVNIEQLTDLKSAVSAVGKRKGPDP
L
SDGPVCKRPALLPSHFV
TSPQTPTPGESMEDVRHSESKLDSSAALLQNIINIKNECNPVSLNTVQVSWM
S
PTVPQNSPRDQCQDFHGGQAFSPPQKYQPFQVSGSPQMMDQASMYQYSPQTQNMQQPPPLPPQQQHQQN
Y
PHNSPLQFSPYSRMSQSPKYDSNLFDTHEPQFCTGQSFVSLLTGPGEPESLAVPVPAPTSIPPQTETQL
Q
TFSLMPSNACEAVVGVHDVGSHSLGTSLSLQNIMGSPMNTTQLGKSFFQWQVEQEESKLANIPQDQFLA
R
DGDGD
TFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNLGAQVNTT
D
CWGRTPLHVCAEKGHSQVLQ
AIQKGAVRSNQFVDLEATNYDGLTPLHCAVVAHNAVVHELQRNRQSHSP
E
VQDLLLRNKSLVDTIKCLIQMGAAVEAK
DRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNG
N
TALHVAASLQYRVTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQ
IRRILKGKSIQQRAPPY



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser