NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49803.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49803.1 Public Mus musculus 16 Kng1 16 104 75 CCDS HistoryNCBI Gene:16644Re-query CCDS DB by CCDS ID:49803.1Re-query CCDS DB by GeneID:16644See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49803.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000089902 ENSMUSP00000087346 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000089902Link to Ensembl Protein Viewer:ENSMUSP00000087346Re-query CCDS DB by Nucleotide ID:ENSMUST00000089902Re-query CCDS DB by Protein ID:ENSMUSP00000087346
Original member Current member EBI,WTSI OTTMUST00000063827 OTTMUSP00000031627 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000063827Link to Vega Protein Viewer:OTTMUSP00000031627Re-query CCDS DB by Nucleotide ID:OTTMUST00000063827Re-query CCDS DB by Protein ID:OTTMUSP00000031627
Original member Current member NCBI NM_001102412.1 NP_001095882.1 Accepted alive Link to Nucleotide Sequence:NM_001102412.1Link to Protein Sequence:NP_001095882.1Re-query CCDS DB by Nucleotide ID:NM_001102412Re-query CCDS DB by Protein ID:NP_001095882Link to BLink:NP_001095882.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001095882.1 480 O08677-3 480 99.7917% 0 1

Chromosomal Locations for CCDS 49803.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 23058444 23058638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23060383 23060493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23061611 23061692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23067695 23067867 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23069218 23069325 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23073358 23073442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23074633 23074805 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23077274 23077381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23077484 23077570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23078974 23079051 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23079595 23079837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1443 nt):
ATGAAGCTCATTACTACACTGCTCCTCTGCTCCGGACTCCTGCTGACTTTAACACAGGGAGAAGAAGCGC
AG
GAAATTGACTGCAATGATGAGGCTGTATTTCAGGCTGTGGATTTCTCTCTGAAGCAGTTTAACCCTGG
G
GTAAAAAGTGGCAACCAGTATATGTTGCACCGAGTGATCGAGGGCACTAAAACGGATGGCTCTCCAACC
TTT
TACTCCTTCAAGTATCTAATCAAGGAGGGCAACTGCTCTGCTCAGAGTGGCCTCGCATGGCAGGACT
GT
GACTTCAAGGACGCTGAGGAAGCCGCCACTGGAGAATGCACAGCAACTGTGGGGAAAAGAGAAAATGA
A
TTCTTCATAGTCACCCAGACCTGCAAGATTGCTCCAAGTAAGGCCCCCATACTGAAAGCCTATTTCCCC
TGT
ATTGGTTGTGTGCATGCCATATCGACAGATAGTCCAGACCTGGAGCCTGTTCTGAAACACTCCATCG
AA
CATTTCAACAACAACACAGATCACAGCCACCTCTTTACTCTCAGAAAAGTAAAAAGTGCCCACAGACA
G
GTGGTGGCTGGCCTGAATTTTGACATTACCTACACAATTGTGCAAACAAATTGTTCAAAGGAGCGTTTT
CCT
TCCCTCCATGGAGACTGCGTGGCCCTTCCCAATGGTGATGATGGTGAATGTAGAGGAAATCTCTTCA
TG
GATATTAATAACAAAATTGCCAACTTCTCACAGAGCTGTACCCTTTATTCAGGAGATGATTTGGTAGA
A
GCGCTTCCCAAGCCTTGCCCTGGCTGCCCCAGGGACATACCTGTAGACAGCCCAGAGCTGAAGGAGGTG
CTT
GGTCATTCCATTGCACAGCTAAATGCAGAGAATGACCATCCTTTCTATTACAAGATTGACACCGTGA
AA
AAAGCAACATCACAGGTGGTAGCAGGAACTAAATATGTTATTGAGTTCATAGCCAGAGAAACCAAATG
C
TCCAAGGAAAGTAACACAGAGCTGGCAGAAGATTGTGAGATCAAGCACCTTGGACAAAGTCTCGACTGC
AAT
GCTAACGTGTACATGAGACCTTGGGAGAACAAAGTCGTCCCGACTGTGAAATGCCAAGCATTAGATA
TG
ACTGAAATGGCAAGAAGGCCTCCAGGTTTTTCTCCTTTCCGGAGTGTCACAGTACAAGAAACAAAAGA
A
GGAAGAACTGACTCAGATTTCATTGAAGATGTGGTAGCTACCACCCCACCATATGACACTGGGGCCCAT
GAT
GATTTGATCCCTGATATCCATGTACAGCCAGATAGCCTTTCATTTAAGCTGATATCTGATTTTCCAG
AA
GCAACTTCCCCCAAATGTCCTGGGCGCCCATGGAAGCCAGCTAGCTGGAAGGATCCAAACACAGAAAC
A
ACAGAATTTTCTGATTTTGATCTCCTTGATGCTCTTTCTTAA


Translation (480 aa):
MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLKQFNPGVKSGNQYMLHRVIEGTKTDGSPT
F
YSFKYLIKEGNCSAQSGLAWQDCDFKDAEEA
ATGECTATVGKRENEFFIVTQTCKIAPSKAPILKAYFP
C
IGCVHAISTDSPDLEPVLKHSIEHFNNNTDHSHLFTLRKVKSAHRQ
VVAGLNFDITYTIVQTNCSKERF
P
SLHGDCVALPNG
DDGECRGNLFMDINNKIANFSQSCTLYSGDDLVEALPKPCPGCPRDIPVDSPELKEV
L
GHSIAQLNAENDHPFYYKIDTVKKATSQ
VVAGTKYVIEFIARETKCSKESNTELAEDCEIKHLGQSLDC
N
ANVYMRPWENKVVPTVKCQALDM
TEMARRPPGFSPFRSVTVQETKEGRTDSDFIEDVVATTPPYDTGAH
D
DLIPDIHVQPDSLSFKLISDFPEATSPKCPGRPWKPASWKDPNTETTEFSDFDLLDALS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser