NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49508.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49508.1 Public Mus musculus 14 Lats2 16 104 75 CCDS HistoryNCBI Gene:50523Re-query CCDS DB by CCDS ID:49508.1Re-query CCDS DB by GeneID:50523See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49508.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000077981 ENSMUSP00000077130 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000077981Link to Ensembl Protein Viewer:ENSMUSP00000077130Re-query CCDS DB by Nucleotide ID:ENSMUST00000077981Re-query CCDS DB by Protein ID:ENSMUSP00000077130
Original member Current member EBI,WTSI OTTMUST00000097032 OTTMUSP00000054324 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000097032Link to Vega Protein Viewer:OTTMUSP00000054324Re-query CCDS DB by Nucleotide ID:OTTMUST00000097032Re-query CCDS DB by Protein ID:OTTMUSP00000054324
Original member Current member NCBI NM_153382.1 NP_700431.1 Accepted alive Link to Nucleotide Sequence:NM_153382.1Link to Protein Sequence:NP_700431.1Re-query CCDS DB by Nucleotide ID:NM_153382Re-query CCDS DB by Protein ID:NP_700431Link to BLink:NP_700431.1

Chromosomal Locations for CCDS 49508.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 57722360 57722551 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57733878 57734216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (531 nt):
ATGAGGCCAAAGACTTTTCCTGCCACAACTTACTCTGGAAATAGCCGGCAGCGATTGCAAGAGATTCGAG
AG
GGGCTGAAGCAGCCATCCAAGGCTTCCACCCAGGGGCTGCTGGTGGGACCAAACAGTGACACTTCCCT
G
GATGCCAAAGTCCTGGGGAGCAAAGATGCCTCCAGGCAGCAGCAAATGAGAGCCACCCCGAAGTTTGGA
CCT
TATCAAAAAGCTCTCAGGGAAATCCGATATTCCCTCCTGCCTTTTGCCAACGAGTCAGGCACTTCGG
CA
GCTGCAGAGGTGAACCGGCAGATGCTTCAGGAGTTGGTGAATGCGGGATGTGACCAGATGCATATTCC
T
GGTGCGTGTCTGTTTCTGGAGATGCTCCTGTCTGTCCCTCCCATCTCCCAAACAGCAGCACCTGGATTA
CAG
GCACACAGGCTGCTACAGCTTTGCAGTGTGTGCGAATTCAAGCTCGGACCCTCACACTTGTACCTGA
AG
CACGGAGCCAGCCGTCTTCTCAGCCCCTTATGTCCATAA


Translation (176 aa):
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDTSLDAKVLGSKDASRQQQMRATPKFG
P
YQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQ
MHIPGACLFLEMLLSVPPISQTAAPGL
Q
AHRLLQLCSVCEFKLGPSHLYLKHGASRLLSPLCP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser