NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49359.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49359.1 Public Mus musculus 13 Pde4d 16 104 75 CCDS HistoryNCBI Gene:238871Re-query CCDS DB by CCDS ID:49359.1Re-query CCDS DB by GeneID:238871

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49359.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000122041 ENSMUSP00000113488 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000122041Link to Ensembl Protein Viewer:ENSMUSP00000113488Re-query CCDS DB by Nucleotide ID:ENSMUST00000122041Re-query CCDS DB by Protein ID:ENSMUSP00000113488
Original member Current member EBI,WTSI ENSMUST00000177907 ENSMUSP00000136485 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000177907Link to Ensembl Protein Viewer:ENSMUSP00000136485Re-query CCDS DB by Nucleotide ID:ENSMUST00000177907Re-query CCDS DB by Protein ID:ENSMUSP00000136485
Original member Current member EBI,WTSI OTTMUST00000079296 OTTMUSP00000042285 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000079296Link to Vega Protein Viewer:OTTMUSP00000042285Re-query CCDS DB by Nucleotide ID:OTTMUST00000079296Re-query CCDS DB by Protein ID:OTTMUSP00000042285
Original member Current member NCBI NM_011056.3 NP_035186.1 Accepted alive Link to Nucleotide Sequence:NM_011056.3Link to Protein Sequence:NP_035186.1Re-query CCDS DB by Nucleotide ID:NM_011056Re-query CCDS DB by Protein ID:NP_035186Link to BLink:NP_035186.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035186.1 747 Q01063-1 747 100% 0 0

Chromosomal Locations for CCDS 49359.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

Chromosome Start Stop Links
13 108860166 108860207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109032468 109032697 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109740387 109740578 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109757577 109757613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109769534 109769607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109772631 109772680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109903577 109903689 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109933868 109933961 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109935306 109935478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109936677 109936775 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109937967 109938131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109939262 109939361 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109948240 109948394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109949414 109949536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109950209 109950391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 109950931 109951344 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2244 nt):
ATGGAGAGGGACACTTGTGATGTACTCTCTCGGAGCAAAAGTGCCTCTGAGGAAACACTGCACTCCTGTA
AT
GAAGAAGAGGACCCTTTTCGTGGAATGGAGCCCTATCTCGTACGGCGACTTTCTTCCCGCAGCATTCA
G
CTTCCACCTCTGGCCTTCAGACAGTTGGAACAAGCAGACTTGCGAAGCGAATCAGAGAACATCCCTCGG
CCA
ACTAGCCTCCCCTTGAAAATCCTGCCTCTGATCGCCGTCACATCTGCAGACTCAAGTGGTTTCGATG
TG
GACAATGGCACATCAGCGGGACGGAGTCCCTTGGATCCCATGACCAGCCCAGGGTCTGGGCTGATTCT
C
CAAGCAAACTTTGTCCACAGTCAACGCCGGGAGTCCTTCCTGTACCGATCTGACAGCGACTATGACCTC
TCT
CCAAAGTCTATGTCCAGGAACTCCTCGATTGCCAGTGATATACATGGAGATGACTTGATTGTGACCC
CG
TTTGCTCAGGTCTTGGCTAGCCTGCGAACCGTACGGAACAACTTTGCTGCGTTAACGAATTTGCAAGA
C
CGAGCACCCAGCAAAAGATCACCCATGTGCAACCAACCATCCATCAACAAAGCCACCATCACAGAGGAG
GCC
TACCAGAAACTGGCCAGCGAGACCCTGGAGGAGCTGGACTGGTGTCTGGACCAGCTAGAGACCCTGC
AG
ACCAGGCACTCCGTCAGTGAGATGGCCTCCAACAAGTTCAAAAGGATGCTGAACCGGGAGCTCACGCA
T
CTCTCTGAGATGAGTCGGTCTGGCAACCAGGTGTCGGAGTACATCTCAAACACATTTCTCGATAAGCAA
CAT
GAAGTGGAAATCCCCTCTCCAACTCAGAAGGAAAAGGAGAAGAAGAAAAGGCCGATGTCGCAGATCA
GT
GGGGTCAAGAAGTTGATGCACAGCTCCAGCCTAACTAATTCATGTATCCCCAGGTTTGGGGTTAAAAC
G
GAGCAGGAAGATGTCCTGGCCAAGGAACTAGAAGATGTGAACAAGTGGGGCCTCCACGTTTTCCGAATA
GCA
GAGCTGTCTGGTAACCGGCCTCTGACTGTTATCATGCACACCATTTTTCAGGAACGAGATTTGTTAA
AA
ACGTTTAAAATCCCAGTAGACACTTTGATTACGTATCTTATGACTCTGGAAGACCATTACCATGCTGA
C
GTGGCCTATCACAACAACATCCATGCTGCAGACGTCGTCCAGTCCACTCACGTGCTGCTCTCTACACCC
GCT
TTGGAGGCTGTGTTCACAGACTTGGAGATTCTCGCGGCCATTTTTGCCAGTGCAATACATGATGTGG
AC
CATCCTGGGGTGTCAAATCAATTTCTGATCAATACAAACTCGGAACTCGCTCTGATGTACAACGACTC
C
TCGGTCCTAGAGAACCATCACTTGGCGGTGGGCTTTAAGTTGCTCCAGGAAGAAAACTGTGACATTTTC
CAG
AATCTGACCAAAAAGCAAAGACAATCTTTAAGGAAAATGGTCATTGACATTGTCCTGGCGACAGACA
TG
TCGAAGCACATGAACCTGCTGGCTGATCTGAAAACCATGGTTGAAACCAAGAAGGTGACAAGCTCCGG
C
GTCCTCCTCCTGGATAACTACTCCGACAGGATCCAGGTCCTTCAGAATATGGTGCACTGTGCAGACCTG
AGC
AACCCCACAAAGCCACTCCAGCTGTACCGCCAGTGGACGGACCGGATAATGGAGGAGTTCTTCCGCC
AG
GGGGACCGAGAGCGGGAGCGTGGCATGGAGATAAGTCCCATGTGTGACAAGCACAACGCCTCTGTGGA
A
AAATCACAGGTGGGCTTCATAGACTATATCGTTCATCCACTCTGGGAGACGTGGGCAGACCTCGTACAT
CCC
GATGCCCAGGACATCTTGGACACTTTGGAGGACAATCGTGAGTGGTACCAGAGCACAATCCCCCAGA
GC
CCCTCCCCTGCACCTGATGACCAAGAGGAGGGCCGGCAGGGACAGACTGAAAAATTCCAGTTTGAACT
A
ACCTTGGAGGAAGACTGCGAGTCAGACACTGAAAAGGACAGTGGAAGTCAGGTGGAGGAAGACACTAGC
TGC
AGTGACTCTAAGACTCTGTGCACCCAAGACTCAGAGTCCACTGAAATTCCCCTTGACGAGCAGGTTG
AG
GAGGAAGCTGTAGCGGAAGAGGAAAGCCAGCCTGAAACTTGCGTCCCAGATGACTGCTGTCCTGATAC
G
TAA


Translation (747 aa):
MERDTCDVLSRSKSASEETLHSCNEEEDPFRGMEPYLVRRLSSRSIQLPPLAFRQLEQADLRSESENIPR
P
TSLPLKILPLIAVTSADSS
GFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDL
S
PKSMSRNSSIASD
IHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEE
A
YQKLASETLEELDWCLDQLETLQTRHSVSEMASNK
FKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQ
H
EVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSCIPRFGVKTEQEDVLAK
ELEDVNKWGLHVFRI
A
ELSGNRPLTVIMHTIFQ
ERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTP
A
LE
AVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIF
Q
NLTKKQRQSLRKMVIDI
VLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADL
S
NPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQ
VGFIDYIVHPLWETWADLVH
P
DAQDILDTLEDNREWYQSTIPQSPSPAPDDQEEGRQGQTEKFQFELTLEEDCESDTEKDSGSQVEEDTS
C
SDSKTLCTQDSESTEIPLDEQVEEEAVAEEESQPETCVPDDCCPDT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser