NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49144.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49144.1 Public Mus musculus 12 Atxn3 16 104 75 CCDS HistoryNCBI Gene:110616Re-query CCDS DB by CCDS ID:49144.1Re-query CCDS DB by GeneID:110616

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49144.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000161011 ENSMUSP00000125378 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161011Link to Ensembl Protein Viewer:ENSMUSP00000125378Re-query CCDS DB by Nucleotide ID:ENSMUST00000161011Re-query CCDS DB by Protein ID:ENSMUSP00000125378
Original member Current member EBI,WTSI OTTMUST00000076081 OTTMUSP00000039989 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076081Link to Vega Protein Viewer:OTTMUSP00000039989Re-query CCDS DB by Nucleotide ID:OTTMUST00000076081Re-query CCDS DB by Protein ID:OTTMUSP00000039989
Original member Current member NCBI NM_001167914.1 NP_001161386.1 Accepted alive Link to Nucleotide Sequence:NM_001167914.1Link to Protein Sequence:NP_001161386.1Re-query CCDS DB by Nucleotide ID:NM_001167914Re-query CCDS DB by Protein ID:NP_001161386Link to BLink:NP_001161386.1

Chromosomal Locations for CCDS 49144.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

Chromosome Start Stop Links
12 101932964 101933064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101934248 101934414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101937337 101937469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101942117 101942204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101945400 101945466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101945834 101945919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101948004 101948048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101948275 101948439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 101958134 101958157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (876 nt):
ATGGAGTCCATCTTCCACGAGAAACAAGAAGGCTCACTTTGTGCTCAGCATTGCCTGAATAACCTATTGC
AA
GGAGAGTATTTTAGCCCTGTGGAGCTATCCTCAATTGCACACCAGCTGGATGAAGAGGAGAGGCTGAG
A
ATGGCAGAAGGGGGAGTCACTAGTGAAGACTACCGCACATTTTTACAGCAGCCTTCTGGAAATATGGAT
GAC
AGCGGCTTTTTCTCTATTCAAGTTATAAGCAATGCTTTGAAAGTTTGGGGTTTAGAACTAATCCTGT
TC
AACAGTCCAGAGTACCAGAGGCTCAGAATTGATCCTATAAACGAAAGATCCTTTATATGCAATTATAA
A
GAACACTGGTTTACAGTTAGAAAATTAGGCAAGCAGTGGTTTAACTTGAATTCTCTGTTGACGGGTCCA
GAA
TTAATATCAGATACATACCTCGCACTATTCTTGGCTCAATTACAGCAAGAAGGTTATTCTATATTTG
TT
GTTAAGGGTGATCTGCCAGATTGTGAAGCTGACCAACTTTTGCAGATGATCAAGGTCCAACAGATGCA
T
CGACCAAAACTTATTGGAGAGGAACTTGCACATCTGAAAGAGCAGAGTGCCCTCAAAGCAGACCTGGAG
CGC
GTCTTAGAAGCAGCTGATGGGTCGGGCATATTTGATGAAGATGAGGATGATTTACAGAGGGCTCTAG
CC
ATAAGTCGCCAGGAAATCGACATGGAGGATGAAGAAGCTGATCTCCGCAGGGCCATTCAGCTCAGTAT
G
CAAGGTAGTTCCAGAAGTATGTGTGAAAATAGTCCACAGACATCAAGTCCAGATCTCTCTTCAGAAGAG
CTG
CGGAGGAGACGAGAAGCCTACTTTGAAAAGTAA


Translation (291 aa):
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSGNMD
D
SGFFSIQ
VISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP
E
LISDTYLALFLAQLQQE
GYSIFVVKGDLPDCEADQLLQMIKVQQMHRPKLIGEELAHLKEQSALKADLE
R
VLEAADGSGIFDEDEDDLQRALAISRQEIDMEDEEADLRRAIQLSMQ
GSSRSMCENSPQTSSPDLSSEE
L
RRRREAYFEK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser