NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48761.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48761.1 Public Mus musculus 11 Efemp1 16 104 75 CCDS HistoryNCBI Gene:216616Re-query CCDS DB by CCDS ID:48761.1Re-query CCDS DB by GeneID:216616

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48761.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020759 ENSMUSP00000020759 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020759Link to Ensembl Protein Viewer:ENSMUSP00000020759Re-query CCDS DB by Nucleotide ID:ENSMUST00000020759Re-query CCDS DB by Protein ID:ENSMUSP00000020759
Original member Current member EBI,WTSI OTTMUST00000011842 OTTMUSP00000005484 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011842Link to Vega Protein Viewer:OTTMUSP00000005484Re-query CCDS DB by Nucleotide ID:OTTMUST00000011842Re-query CCDS DB by Protein ID:OTTMUSP00000005484
Original member Current member NCBI NM_146015.2 NP_666127.2 Accepted alive Link to Nucleotide Sequence:NM_146015.2Link to Protein Sequence:NP_666127.2Re-query CCDS DB by Nucleotide ID:NM_146015Re-query CCDS DB by Protein ID:NP_666127Link to BLink:NP_666127.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_666127.2 493 Q8BPB5 493 100% 0 0

Chromosomal Locations for CCDS 48761.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 28854474 28854554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28867466 28867514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28867653 28868039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28910610 28910732 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28914588 28914707 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28915661 28915780 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28916850 28916969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28921403 28921526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28921611 28921806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 28926157 28926318 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1482 nt):
ATGTTGCAAACACTTTTCCTAACTATGCTGACTCTGGCGCTGGTCAAGTCACAGTACACCGAGGAAACCA
TC
ACATACACGCAATGCACCGATGGATATGAATGGGACCCCATAAGACAGCAGTGTAAAGATATTGATGA
A
TGTGACATTGTCCCAGATGCTTGCAAAGGTGGAATGAAATGTGTCAACCACTATGGAGGATATCTCTGC
CTT
CCTAAAACAGCCCAAATTATTGTCAATAATGAGCATCCTCAGCAAGAAACACCAGCTGCAGAAGCTT
CG
TCAGGTGCCACCACTGGGACTGTAGCTGCCAGGAGCATGGCAACCAGTGGTGTGGTGCCTGGGGGTGG
C
TTCATGGCCAGTGCTACTGCAGTTGCTGGCCCTGAAGTTCAAACTGGCCGAAATAACTTTGTCATCCGA
AGA
AACCCAGCTGACCCTCAGCGCATCCCTTCCAACCCTTCCCACCGGATCCAGTGTGCAGCAGGCTATG
AA
CAGAGTGAGCATAATGTGTGCCAAGATATTGATGAGTGCACCTCAGGGACTCACAATTGTAGAACGGA
C
CAAGTATGCATCAATTTACGAGGTTCCTTCACATGTCAGTGTCTTCCTGGGTATCAGAAGCGAGGTGAA
CAG
TGTGTGGATATAGATGAATGCACAGTGCCTCCATATTGCCACCAAAGATGTGTTAACACACCTGGTT
CC
TTCTACTGCCAGTGCAGTCCAGGGTTTCAGCTGGCAGCAAACAACTACACTTGTGTGGATATAAATGA
A
TGTGATGCCAGCAACCAGTGTGCTCAACAATGCTACAACATTCTTGGCTCATTCATCTGTCAGTGTAAT
CAA
GGATATGAACTAAGCAGTGACAGACTCAACTGTGAAGACATCGACGAATGCAGAACCTCAAGCTACC
TA
TGCCAATATCAATGTGTCAATGAACCTGGGAAGTTCTCATGTATGTGCCCACAGGGTTACGAAGTGGT
G
CGCAGCAGAACCTGTCAGGATATAAATGAATGTGAGACCACCAATGAATGCCGAGAAGATGAGATGTGC
TGG
AATTACCATGGGGGCTTCCGCTGTTACCCACGAAACCCATGTCAAGATCACTATGTTCTAACATCAG
AA
AACCGATGTGTTTGCCCAGTCTCAAACACTATGTGCCGGGAGCTGCCCCAGTCCATTGTCTACAAATA
C
ATGAGCATCCGATCTGACAGGTCCGTGCCTTCAGACATCTTCCAGATACAGGCAACAATGATTTATGCA
AAC
ACCATTAATACTTTTCGGATTAAATCTGGAAATGAAAATGGAGAGTTCTACCTACGACAAACAAGCC
CT
GTGAGTGCAATGCTGGTGCTTGTGAAGTCTCTATCAGGACCAAGAGAATACATCGTGGACCTGGAGAT
G
CTGACAGTCAGTAGTATAGGAACCTTCCGCACAAGCTCTGTGTTAAGATTGACAATAATAGTGGGGCCA
TTT
TCATTTTAG


Translation (493 aa):
MLQTLFLTMLTLALVKSQYTEETITYTQCTDGYEWDPIRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC
L
PKTAQIIVNNEHPQQETPAAEASSGATTGTVAARSMATSGVVPGGGFMASATAVAGPEVQTGRNNFVIR
R
NPADPQRIPSNPSHRIQCAAGYEQSEHNVCQ
DIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGE
Q
CV
DIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCN
Q
GYELSSDRLNCE
DIDECRTSSYLCQYQCVNEPGKFSCMCPQGYEVVRSRTCQDINECETTNECREDEMC
W
NYHGGFRCYPRNPCQDHYVLTSE
NRCVCPVSNTMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATMIYA
N
TINTFRIKSGNENGEFYLR
QTSPVSAMLVLVKSLSGPREYIVDLEMLTVSSIGTFRTSSVLRLTIIVGP
F
SF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser