NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48689.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48689.1 Public Mus musculus 10 Bbs10 16 104 75 CCDS HistoryNCBI Gene:71769Re-query CCDS DB by CCDS ID:48689.1Re-query CCDS DB by GeneID:71769

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48689.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040454 ENSMUSP00000049387 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040454Link to Ensembl Protein Viewer:ENSMUSP00000049387Re-query CCDS DB by Nucleotide ID:ENSMUST00000040454Re-query CCDS DB by Protein ID:ENSMUSP00000049387
Original member Current member NCBI NM_027914.1 NP_082190.1 Accepted alive Link to Nucleotide Sequence:NM_027914.1Link to Protein Sequence:NP_082190.1Re-query CCDS DB by Nucleotide ID:NM_027914Re-query CCDS DB by Protein ID:NP_082190Link to BLink:NP_082190.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082190.1 713 Q9DBI2 713 100% 0 0

Chromosomal Locations for CCDS 48689.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

Chromosome Start Stop Links
10 111298723 111298907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 111299213 111301169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2142 nt):
ATGGCGTCCCAGGGGTCGGTGACGGCGGCTTTGCGGGTGGCCGAGGTGCTGGAGAGCATCGCGAACCGCT
GC
GTGGGGCCCGAGGGCGGCCAAGTGTTGTGTACGAAGCCCACCGGCGAGGTGCTGCTTAGCAGGGATGG
A
GGCTGCCTCCTGGAGGCGCTGCACTTAGAGCATCCCTTAGCCAGGATGATAGTGGCGTGTGTTTCCAGT
CAC
CTTAAAAAGACAGGAGATGGTGCTAAGACATTTATTATTTTTCTTTGCCATTTACTCAGAGGACTTC
AT
GCAATCGGAGAAAAAGGAAAAGATTCATTCACTTCTGAAAATATTCAGAGCCATGAAAGGCATTGGAA
A
AACTGTTGTCAGTGGAAATCTATTTCCCAGGCTCTGCAAACGTTTCAGACACAAACCCTAGGTTGTATT
GTA
GACCGGAGTTTAAGCAGGCACTACCTGTCTGTCTTTTCTTCATCCACTGAAGGAAGAAAACTGTGCA
GG
CACTCGCTAGAGTTGCTCCTGGAAGCATACTTTTGTGGAAGAGTGGGAAGAAACAATCACAGATTCAT
T
TCACAGTTGATGTGTGACTACGTTTTCAAGTGTATGGCTTGTGAAAGTGGGGTTGAAGTATTTGAGTTG
TTG
GATCACTGTTTTGCAGAGTTGAATGTTGGCGTGACAGGCCTTCCTGTTTCAGATTCTAGAATCATAG
AT
GGCCTTGTGCTTCCCAGGGACTTTTCTATGTACTGCCCAGCAGATGGTGACATTAGGATGGTGATAGT
A
ACAGAAATCCTCCAGCCTCAGTTTTCATCGGCTGGCTCGGAGTTTGTTCTCAATTCAGAAACACAGTTT
CAG
GCATCTCAGTGCTGGATCACGGACAGGACAAAAACAGTAATGAACCACTTGCGTGGTCAGAATGTAA
AA
CTGCTCCTGACCAGTGTGAAGCAACCAGACCTGGTTATTTACTGTGCAAGACTTAATAGCATATCAGT
G
GTGGAGTGTTTATCAGCCGAAGAAGTTTCCCTTGTCCAGAGGATCACTGGTCTTTCTCCTTGTGTCCTA
CCA
GAGGTTGCTTCACAGTGTGAAATTTCTGATAGTACTTTGGTGAAGTTTTGCAAGCCCCTCATCCTTA
GA
TCCAAGAGGTATGTTCATCTCGGCTTGATTAGCACATGTGCATTTATACCTCACTCTATGGTCCTCTG
T
GGACCGGTTCTGGGTCTTGTTGAACAGCATGAGAGAGCTTTTCACGGAGCATTTAAGATGCTTCGGCAG
CTA
TTTACTGACCTTGATCTAAATTACATCATACAAACCAAACAGCAATGTAACCCAAGTCCTCTTGCTT
AT
GACAATAGCAGAGAGCGTAATCACTCACCAGAAACTGATAAGTATCAGGACATAGTAGCAAAGAGCAA
A
AATAAATTGGAAACTCAAACACATTTAGAAGTATATTCAGGTTTGGGGGCTTCAGATACAGAATTGAGA
GCA
GGTAAGCCGTGGTCAGCACACAAGAAGACACCAATAGCTCCATCCCAAACAGATGAAATGCTGAAGT
GC
TTGCCTCCAGAAAGAAGCGGGATAATTGATAACTGTGACCTGTCAATTGAGAATCATTCCACTGGAAA
T
CCTACAGCAGAAGACACTGGAACAGAAATTTCTTTCGAACACTTACAGGTCTCAGATAATGCCGGAAAG
GGT
TACACGCTGCCAGTGATGCGCAAGTCACTAGATACCTGTACTTGTCAGGGTTATTGTTCATCCACTG
TG
CCAGCAGGCTGTGTGCTGCCAGTGGGTGGAAGTTTTGAGATTTTGATGAGTTACTACCTTCTCAGCTA
T
GCCAAACAATGCCGACAATCAGATGAAACTGTCATCAGTATGTTAATAGCTGATGCTCTTCTAGGCATC
CCT
AAAATCCTTTATAAGCCTAAGAAGGGAAAGGACAGTTTCCCACACATATACATGCGGTCTCTCCATG
CA
CTGCAAGCCAGTCAACCCATGGTAAGTGGTCAATCAGGGTTCGAGTCAGTAGCTGGTAAGTACCAATT
A
CTAACTTCAGTTCTTCAGTGTTTGATGAAAATATTAACCATTGATTTAATAATCAACATCAAGAGGCAA
CCT
CAGAAAACTGCTGACCAAGAATCAGAAGACGAATTTTAA


Translation (713 aa):
MASQGSVTAALRVAEVLESIANRCVGPEGGQVLCTKPTGEVLLSRDGGCLLEALHLEHPLARMIVACVSS
H
LKKTGDGAKTFIIFLCHLLRGLHAIGEKGKDSFTSENIQSHERHWKNCCQWKSISQALQTFQTQTLGCI
V
DRSLSRHYLSVFSSSTEGRKLCRHSLELLLEAYFCGRVGRNNHRFISQLMCDYVFKCMACESGVEVFEL
L
DHCFAELNVGVTGLPVSDSRIIDGLVLPRDFSMYCPADGDIRMVIVTEILQPQFSSAGSEFVLNSETQF
Q
ASQCWITDRTKTVMNHLRGQNVKLLLTSVKQPDLVIYCARLNSISVVECLSAEEVSLVQRITGLSPCVL
P
EVASQCEISDSTLVKFCKPLILRSKRYVHLGLISTCAFIPHSMVLCGPVLGLVEQHERAFHGAFKMLRQ
L
FTDLDLNYIIQTKQQCNPSPLAYDNSRERNHSPETDKYQDIVAKSKNKLETQTHLEVYSGLGASDTELR
A
GKPWSAHKKTPIAPSQTDEMLKCLPPERSGIIDNCDLSIENHSTGNPTAEDTGTEISFEHLQVSDNAGK
G
YTLPVMRKSLDTCTCQGYCSSTVPAGCVLPVGGSFEILMSYYLLSYAKQCRQSDETVISMLIADALLGI
P
KILYKPKKGKDSFPHIYMRSLHALQASQPMVSGQSGFESVAGKYQLLTSVLQCLMKILTIDLIINIKRQ
P
QKTADQESEDEF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser