NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48661.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48661.1 Public Mus musculus 10 Igf1 16 104 75 CCDS HistoryNCBI Gene:16000Re-query CCDS DB by CCDS ID:48661.1Re-query CCDS DB by GeneID:16000See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48661.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000095360 ENSMUSP00000093005 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095360Link to Ensembl Protein Viewer:ENSMUSP00000093005Re-query CCDS DB by Nucleotide ID:ENSMUST00000095360Re-query CCDS DB by Protein ID:ENSMUSP00000093005
Original member Current member EBI,WTSI ENSMUST00000122386 ENSMUSP00000113905 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000122386Link to Ensembl Protein Viewer:ENSMUSP00000113905Re-query CCDS DB by Nucleotide ID:ENSMUST00000122386Re-query CCDS DB by Protein ID:ENSMUSP00000113905
Original member Current member EBI,WTSI OTTMUST00000077770 OTTMUSP00000041203 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000077770Link to Vega Protein Viewer:OTTMUSP00000041203Re-query CCDS DB by Nucleotide ID:OTTMUST00000077770Re-query CCDS DB by Protein ID:OTTMUSP00000041203
Original member Current member EBI,WTSI OTTMUST00000077813 OTTMUSP00000041239 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000077813Link to Vega Protein Viewer:OTTMUSP00000041239Re-query CCDS DB by Nucleotide ID:OTTMUST00000077813Re-query CCDS DB by Protein ID:OTTMUSP00000041239
Original member Current member NCBI NM_001111275.1 NP_001104745.1 Accepted alive Link to Nucleotide Sequence:NM_001111275.1Link to Protein Sequence:NP_001104745.1Re-query CCDS DB by Nucleotide ID:NM_001111275Re-query CCDS DB by Protein ID:NP_001104745Link to BLink:NP_001104745.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001104745.1 153 P05017-1 153 100% 0 0

Chromosomal Locations for CCDS 48661.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 87859350 87859412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 87864731 87864887 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 87913619 87913800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 87930675 87930734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (462 nt):
ATGGGGAAAATCAGCAGCCTTCCAACTCAATTATTTAAGATCTGCCTCTGTGACTTCTTGAAGATAAAGA
TA
CACATCATGTCGTCTTCACACCTCTTCTACCTGGCGCTCTGCTTGCTCACCTTCACCAGCTCCACCAC
A
GCTGGACCAGAGACCCTTTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGACCGAGGGGC
TTT
TACTTCAACAAGCCCACAGGCTATGGCTCCAGCATTCGGAGGGCACCTCAGACAGGCATTGTGGATG
AG
TGTTGCTTCCGGAGCTGTGATCTGAGGAGACTGGAGATGTACTGTGCCCCACTGAAGCCTACAAAAGC
A
GCCCGCTCTATCCGTGCCCAGCGCCACACTGACATGCCCAAGACTCAGAAGGAAGTACATTTGAAGAAC
ACA
AGTAGAGGAAGTGCAGGAAACAAGACCTACAGAATGTAG


Translation (153 aa):
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRG
F
YF
NKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKEVHLKN
T
SRGSAGNKTYRM




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser