NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48406.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48406.1 Public Mus musculus 1 Ralgps2 16 104 75 CCDS HistoryNCBI Gene:78255Re-query CCDS DB by CCDS ID:48406.1Re-query CCDS DB by GeneID:78255

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48406.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027886 ENSMUSP00000027886 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027886Link to Ensembl Protein Viewer:ENSMUSP00000027886Re-query CCDS DB by Nucleotide ID:ENSMUST00000027886Re-query CCDS DB by Protein ID:ENSMUSP00000027886
Original member Current member NCBI NM_001159967.1 NP_001153439.1 Accepted alive Link to Nucleotide Sequence:NM_001159967.1Link to Protein Sequence:NP_001153439.1Re-query CCDS DB by Nucleotide ID:NM_001159967Re-query CCDS DB by Protein ID:NP_001153439Link to BLink:NP_001153439.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153439.1 564 Q9ERD6-3 564 100% 0 0

Chromosomal Locations for CCDS 48406.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

Chromosome Start Stop Links
1 156809164 156809193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156811445 156811536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156813438 156813543 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156817741 156817833 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156819813 156819918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156823991 156824045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156828140 156828291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156828972 156829128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156830385 156830452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156832665 156832755 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156832895 156833032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156869441 156869567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156884533 156884625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156887091 156887180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156887947 156888030 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156900586 156900636 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156901786 156901890 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156907639 156907695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1695 nt):
ATGGACCTAATGAACGGGCAGGCAAGCAGTGTTACTATCGCAGCCACTGTTTCCGAGAAGAGTAGCAGCT
CT
GAGTCACTAAGCGAGAAGGGCTCTGAATTGAAGAAAAGCTTTGATGCTGTGGTGTTTGATGTTCTTAA
G
GTTACGCCAGAAGAATACGCGGGTCAGATAACACTAATGGATGTTCCAGTGTTTAAAGCTATTCAGCCA
GAT
GAACTTTCAAGTTGTGGATGGAATAAAAAAGAAAAATATAGTTCTGCACCAAATGCAGTTGCTTTCA
CA
AGAAGATTTAATCACGTAAGCTTTTGGGTTGTAAGAGAGATTCTCCATGCTCAAACACTGAAAATAAG
A
GCAGAAGTTTTGAGCCACTATATTAAGACTGCTAAGAAACTATATGAACTTAACAACCTTCACGCACTT
ATG
GCTGTGGTTTCTGGCTTACAGAGTGCGCCGATTTTCCGGTTGACTAAGACGTGGGCGTTATTAAGTC
GA
AAAGACAAAACTACCTTTGAAAAACTAGAATATGTAATGAGTAAAGAAGATAACTACAAAAGACTCAG
A
GACTATATAAGCAGCTTAAAGATGACTCCTTGCATTCCCTATTTAGGCATCTATTTGTCTGACTTGACC
TAC
ATTGACTCCGCGTACCCATCCACCGGCAGCATTCTAGAAAATGAGCAAAGATCAAATCTGATGAACA
AC
ATTCTTCGAATAATTTCTGATTTGCAGCAGTCCTGTGAATATGATATTCCCATATTGCCTCATGTCCA
A
AAATACCTGAACTCTGTTCAGTATATAGAAGAACTACAAAAGTTTGTGGAAGACGATAATTACAAGCTC
TCC
TTAAAGATAGAACCAGGAGCAAGTACTCCACGCTCGGCTGCCTCCAGGGAGGACCTAGCAGGTCCTG
AC
ATAGGCGCCTCACCCCAGGGAGGGAGGAAGAGTAGTGCTGCTGCTGCTGCCGCCGCGGCTGCCGAGGG
A
GCCTTACTGCCACAGACGCCACCTTCCCCTCGGAACCTCATTCCACACGGACACAGGAAGTGCCACAGC
CTG
GGTTACAATTTCATTCATAAGATGAACACAGCAGAGTTTAAGAGCGCAACGTTCCCAAACGCAGGGC
CA
CGGCACCTGCTGGATGATAGTGTCATGGAGCCGCACGCACCGTCGCGAGGCCAGGCTGAGAGCTCTAC
A
CTTTCCAGTGGAATATCCATAGGGAGCAGTGATGGTTCTGAACTAAGCGAAGAGACCTCATGGCCGGCT
TTT
GAAAGCTCTGCGGAGTCGGAAGATTTGGCGGTGCATCTGTACCCCGGAGCTGTTACTATTCAAGGTG
TG
CTCCGGAGGAAAACCTTGCTAAAAGAAGGCAAGAAACCCACAGTAGCATCTTGGACAAAGTATTGGGC
A
GCCTTGTGTGGAACACAGCTTTTTTACTATGCCGCCAAATCTCTGAAGGCTACAGAAAGAAAGCATTTC
AAA
TCAACGTCAAATAAGAATGTGTCTGTGGTGGGCTGGATGGTGATGATGGCTGACGACCCAGAGCATC
CA
GACCTCTTTCTGCTGACTGACTCCGAGAAAGGAAATTCATACAAGTTTCAAGCTGGCAGCAGGATGAA
T
GCAATGCTGTGGTTTAAACACTTGAGCGCGGCCTGCCAGAGTAACAAGCAACAGGTTCCTACAAACTTG
ATG
ACTTTTGAGTAA


Translation (564 aa):
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQP
D
ELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHAL
M
AVVSGLQSAPIFRLTKTWA
LLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLT
Y
IDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEY
DIPILPHVQKYLNSVQYIEELQKFVEDDNYKL
S
LKIEPGASTPRSAASREDLA
GPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHS
L
GY
NFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPA
F
E
SSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHF
K
STSNKNVSVVGWMVMMADDPEHPDLFLLTDSEK
GNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNL
M
TFE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser