NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48380.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48380.1 Public Mus musculus 1 Cacna1s 16 104 75 CCDS HistoryNCBI Gene:12292Re-query CCDS DB by CCDS ID:48380.1Re-query CCDS DB by GeneID:12292

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48380.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112068 ENSMUSP00000107699 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112068Link to Ensembl Protein Viewer:ENSMUSP00000107699Re-query CCDS DB by Nucleotide ID:ENSMUST00000112068Re-query CCDS DB by Protein ID:ENSMUSP00000107699
Original member Current member EBI,WTSI OTTMUST00000085065 OTTMUSP00000045912 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000085065Link to Vega Protein Viewer:OTTMUSP00000045912Re-query CCDS DB by Nucleotide ID:OTTMUST00000085065Re-query CCDS DB by Protein ID:OTTMUSP00000045912
Original member Current member NCBI NM_014193.2 NP_055008.2 Accepted alive Link to Nucleotide Sequence:NM_014193.2Link to Protein Sequence:NP_055008.2Re-query CCDS DB by Nucleotide ID:NM_014193Re-query CCDS DB by Protein ID:NP_055008Link to BLink:NP_055008.2

Chromosomal Locations for CCDS 48380.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 136052901 136053052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136054579 136054684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136068921 136069060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136070634 136070776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136070910 136071062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136073507 136073712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136075067 136075170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136076727 136076872 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136077629 136077710 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136079479 136079639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136084215 136084440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136085292 136085499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136086684 136086804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136087324 136087438 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136088303 136088396 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136089020 136089089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136091698 136091830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136092587 136092716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136093260 136093319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136094881 136094987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136095463 136095550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136095770 136095877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136097078 136097130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136097365 136097511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136098172 136098373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136098532 136098690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136100600 136100710 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136101479 136101562 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136105448 136105576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136105784 136105849 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136106402 136106493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136107017 136107176 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136108080 136108207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136110866 136110962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136111978 136112080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136112910 136113011 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136113283 136113407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136115148 136115276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136115925 136116175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136117607 136117692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136118336 136118427 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136118661 136118813 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 136118957 136119130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5496 nt):
ATGGAGCCGCCCTCACCCCAGGACGAGGGCCTGAGGAAGAAGCAGCCGAAGAAACCTGTTCCTGAGATTC
TG
CCGAGGCCCCCGCGGGCCTTGTTCTGCCTGACTCTACAGAACCCCCTGAGGAAGGCCTGCATCAGCAT
C
GTGGAATGGAAACCCTTCGAGACCATCATCTTGCTCACCATCTTTGCCAACTGTGTGGCCCTGGCAGTG
TAC
CTGCCCATGCCAGAGGATGACAACAACACTCTGAACCTCGGCCTGGAGAAACTGGAGTACTTCTTCC
TC
ATTGTCTTCTCCATTGAAGCCGCCATGAAGATCATAGCCTACGGCTTCCTATTCCATCAGGATGCATA
C
CTGCGCAGTGGCTGGAACGTTCTGGACTTCATCATTGTCTTTCTGGGGGTCTTCACTGTGATTCTGGAA
CAA
GTTAACATCATTCAAACCAACACGGCCCCCATGAGCAGCAAAGGAGCCGGCTTGGATGTGAAGGCCC
TT
CGAGCATTCCGCGTGCTCAGACCCCTGCGGCTGGTGTCGGGGGTGCCCAGTCTTCAGGTGGTCCTCAA
C
TCCATCTTCAAGGCCATGCTCCCCCTGTTCCACATTGCCCTGCTCGTCCTCTTCATGGTCATCATCTAC
GCC
ATCATTGGGCTGGAGCTCTTCAAAGGCAAGATGCACAAGACTTGCTACTTCATTGGGACAGACATTG
TA
GCCACAGTTGAGAATGAGAAACCATCACCCTGTGCTAGAACTGGCTCTGGGCGTCCCTGCACCATCAA
T
GGCAGCGAGTGCCGAGGAGGTTGGCCAGGACCCAACCACGGCATCACCCACTTCGACAACTTTGGCTTC
TCT
ATGCTCACTGTGTATCAATGCATCTCCATGGAGGGGTGGACTGATGTCCTGTACTGGGTCAACGATG
CC
ATCGGGAATGAGTGGCCCTGGATCTACTTTGTCACCCTCATTCTGCTGGGCTCCTTCTTCATCCTCAA
C
CTGGTGCTGGGTGTCCTGAGTGGAGAATTCACCAAAGAGCGAGAGAAGGCCAAGTCCAGGGGAACCTTC
CAA
AAGCTCCGAGAGAAACAGCAGCTGGAGGAGGACCTCCGTGGTTACATGAGCTGGATCACACAGGGCG
AG
GTCATGGACGTGGACGACTTGAGAGAAGGCAAGCTGTCTTTGGATGAAGGGGGATCAGACACAGAGAG
C
TTGTATGAAATCGAAGGCTTGAACAAAATCATCCAGTTCATTCGGCACTGGCGACAGTGGAATCGCGTC
TTC
CGCTGGAAGTGCCATGACCTAGTGAAATCCAAGGTCTTCTATTGGCTGGTGATCCTGATCGTTGCCC
TA
AACACCCTGTCCATTGCCTCGGAGCACCACAACCAGCCACTCTGGTTGACCCATTTGCAAGATGTTGC
C
AACCGCGTGTTGCTGACCCTCTTCACCATCGAAATGCTCATGAAGATGTACGGGCTGGGCCTGCGCCAG
TAC
TTCATGTCCATCTTCAACCGCTTCGACTGCTTCGTGGTGTGCAGCGGCATCCTGGAGATCCTGCTGG
TG
GAGTCGGGAGCCATGTCGCCCCTGGGCATCTCTGTGCTCCGCTGTATCCGCCTCCTGAGGCTCTTCAA
G
ATCACCAAGTACTGGACATCGCTGAGCAACCTGGTGGCCTCACTGCTCAACTCCATCCGCTCCATTGCT
TCC
CTCTTGCTGCTGCTCTTTCTCTTCATCATCATCTTTGCCCTGCTGGGCATGCAGCTCTTTGGAGGCA
GA
TATGACTTTGAAGACACAGAAGTACGACGAAGCAACTTTGACAACTTCCCCCAGGCCCTCATCAGTGT
C
TTCCAGGTCCTGACGGGTGAAGACTGGAACTCTGTGATGTACAATGGGATCATGGCTTACGGAGGTCCG
ACC
TACCCTGGTGTGCTGGTGTGCATTTATTTCATCATCCTTTTCGTCTGTGGCAACTACATCCTTCTCA
AC
GTCTTCCTGGCTATTGCTGTGGACAACCTGGCAGAGGCAGAGAGTCTGACATCTGCCCAAAAGGCCAA
G
GCTGAGGAGAGAAAGCGCAGGAAGATGTCGAAAGGGCTCCCAGACAAGTCAGAAGAGGAGAGGGCCACG
GTG
ACCAAGAAACTGGAGCAGAAGTCCAAGGGTGAAGGCATCCCCACCACCGCCAAGCTGAAAATCGATG
AG
TTTGAATCAAACGTTAATGAGGTGAAAGACCCCTACCCTTCGGCTGACTTCCCAGGGGACGATGAGGA
A
GATGAGCCCGAGATCCCAGTGAGCCCCCGACCACGCCCTCTGGCCGAGCTGCAGCTGAAAGAGAAAGCA
GTG
CCCATCCCGGAGGCTAGCTCCTTCTTCATCTTCAGTCCCACCAACAAGATCCGTGTCCTGTGTCACC
GC
ATTGTCAATGCCACCTGGTTCACCAACTTCATCCTGCTCTTCATCCTGCTCAGCAGTGCCGCCCTGGC
C
GCTGAGGATCCCATCCGGGCCGACTCCATGAGGAATCAGATCCTCGAGTATTTTGATTATGTGTTCACT
GCT
GTTTTCACGGTGGAGATTGTCCTTAAGATGACCACCTATGGAGCCTTCCTGCACAAAGGCTCCTTCT
GC
CGCAACTACTTCAACATCCTGGACCTGCTGGTGGTGGCTGTGTCCCTCATCTCCATGGGCCTCGAGTC
C
AGCGCCATCTCCGTGGTGAAGATCTTAAGGGTTCTGAGAGTGCTGAGACCACTCCGGGCCATAAACAGA
GCC
AAAGGGTTGAAGCACGTGGTGCAGTGCGTGTTTGTTGCCATTCGCACCATCGGGAACATCGTGCTGG
TC
ACCACGCTCCTGCAGTTCATGTTTGCGTGCATTGGAGTGCAGCTTTTCAAGGGAAAGTTCTACAGCTG
C
AATGACTTATCCAAGATGACTGAAGAGGAATGCAGGGGCTACTACTACATATACAAGGATGGAGACCCC
ACT
CAGATAGAGCTGCGTCCCCGCCAGTGGATACACAATGACTTCCACTTTGACAATGTACTCTCCGCTA
TG
ATGTCACTCTTCACGGTCTCCACCTTCGAGGGTTGGCCTCAGCTACTGTACAAGGCCATAGACTCAAA
T
GAGGAGGACACCGGCCCTGTCTACAACAACCGAGTGGAGATGGCCATCTTCTTCATTATCTACATCATC
CTC
ATTGCCTTCTTCATGATGAACATCTTTGTGGGCTTTGTCATCGTTACCTTCCAGGAACAGGGAGAGA
CT
GAGTATAAGAACTGTGAGCTCGACAAGAACCAGCGCCAATGCGTACAGTATGCCCTGAAGGCCCGCCC
A
CTGAGGTGTTACATCCCCAAAAACCCATACCAGTATCAGGTGTGGTATGTCGTCACTTCCTCCTACTTT
GAA
TACCTGATGTTTGCTCTCATCATGCTCAATACTATCTGCCTGGGCATGCAGCATTACAACCAGTCGG
AA
CAGATGAACCACATCTCAGACATTCTCAACGTGGCTTTCACCATCATCTTCACCCTGGAGATGGTCCT
C
AAGCTCATAGCTTTCAAGCCCAGGGGCTATTTTGGAGATCCTTGGAATGTGTTTGACTTCCTAATCGTC
ATC
GGCAGCATCATTGACGTCATCCTGAGCGAGATCGATGACCCAGATGAGAGCGCCCGTATCTCCAGTG
CC
TTCTTCCGCCTGTTCCGGGTCATGAGACTGGTCAAGCTGCTGAACCGGGCGGAGGGTGTGCGCACCCT
G
CTGTGGACATTCATCAAGTCCTTCCAGGCCCTGCCGTACGTGGCTTTGCTGATCGTGATGCTCTTCTTC
ATC
TACGCGGTCATCGGCATGCAGATGTTCGGGAAGATCGCCATGGTGGACGGGACGCAGATAAACCGGA
AC
AACAACTTCCAGACTTTCCCACAGGCCGTGCTGCTGCTCTTCAGGTGTGCCACAGGGGAAGCCTGGCA
A
GAGATCCTGCTGGCCTGCAGCTATGGGAAGCTGTGTGACCCGGAGTCTGACTACGCACCCGGGGAGGAG
CAT
ACATGCGGCACCAACTTCGCCTACTACTACTTCATCAGTTTCTACATGCTCTGCGCCTTCCTGATCA
TC
AACCTCTTTGTGGCTGTCATCATGGACAACTTTGATTACCTCACAAGGGACTGGTCCATTCTGGGCCC
T
CACCACCTGGACGAGTTCAAGGCCATTTGGGCTGAGTACGACCCGGAGGCTAAGGGCAGGATCAAGCAC
CTG
GATGTGGTGACCCTGCTGAGGAGGATTCAGCCCCCTCTGGGCTTTGGGAAGTTCTGCCCACACAGGG
TA
GCATGTAAGAGGCTGGTGGGCATGAACATGCCCCTGAACAGCGATGGCACAGTCACCTTTAATGCCAC
A
CTATTTGCCCTGGTGCGCACAGCCCTCAAGATCAAGACAGAAGGCAACTTTGAACAAGCTAACGAGGAG
CTG
AGAGCCATCATCAAGAAGATCTGGAAGAGAACCAGCATGAAGCTCTTGGACCAAGTCATCCCTCCAA
TA
GGAGATGATGAGGTGACAGTAGGGAAATTCTATGCCACATTCCTCATCCAGGAGCACTTCCGGAAGTT
C
ATGAAGCGCCAGGAGGAATATTATGGGTATCGACCCAAAAAGGACACAGTTCAGATACAGGCTGGATTA
CGG
ACCATAGAGGAAGAGGCAGCTCCTGAGATCCACCGTGCCATCTCTGGAGACCTGACAGCAGAGGAGG
AA
CTGGAGAGGGCCATGGTAGAGGCTGCCATGGAGGAGGGGATATTCCGGAGGACGGGAGGCCTGTTTGG
T
CAAGTGGACAACTTCCTGGAAAGGACCAACTCTCTGCCCCCTGTCATGGCCAACCAAAGACCCCTCCAA
TTT
GCTGAAATAGAGATGGAAGAGCTGGAGTCACCAGTCTTCTTGGAGGACTTCCCTCAGAACCCAGGCA
CC
CACCCTCTTGCTCGTGCCAATACCAACAACGCCAATGCCAATGTTGCCTATGGCAACAGCAGCCATAG
A
AACAACCCAGTGTTTTCCAGCATCTGCTATGAACGGGAGTTCTTGGGAGAGGCGGACATGCCTGTTACC
AGA
GAAGGACCCCTCAGTCAGCCCTGCAGGGCCTCAGGACCTCACAGCAGATCTCATGTGGACAAACTGA
AA
AGACCGATGACCCAGAGAGGAATGCCTGAAGGCCAGGTGCCTCCTTCCCCGTGCCAGCTCTCCCAGGC
A
GAGCATCCTGTGCAGAAAGAGGGAAAGGGCCCCACGTCACGGTTTCTGGAAACACCCAACAGCAGGAAC
TTT
GAGGAGCACGTTCCCAGGAATTCGGCTCACAGGTGCACGGCTCCAGCTACTGCCATGCTGATCCAGG
AG
GCTCTGGTTCGAGGAGGACTAGACTCCTTAGCAGCAGATGCTAACTTCGTCATGGCAACAGGCCAGGC
C
CTGGCAGATGCCTGCCAGATGGAACCAGAGGAAGTCGAGGTGGCAGCAACAGAGCTACTGAAGCAAGAA
TCC
CCAGAGGGCGGGGCCGTGCCCTGGGAGCCTTGA


Translation (1831 aa):
MEPPSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAV
Y
LPMPEDDNNTLNLGL
EKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILE
Q
VNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIY
A
IIGLELFKGKMHKTCYFIGT
DIVATVENEKPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGF
S
MLTVYQCISMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTF
Q
KLREKQQLEEDLRGYMSWITQGEVMDVDDLRE
GKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRV
F
RWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQ
DVANRVLLTLFTIEMLMKMYGLGLRQ
Y
FMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKIT
KYWTSLSNLVASLLNSIRSIA
S
LLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQ
VLTGEDWNSVMYNGIMAYGGP
T
YPGVLVCIYFIILFVCGN
YILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEERAT
V
TKKLEQKSKGEGIPTTAK
LKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKA
V
PIPEASSFFIFSPTN
KIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFT
A
VFTVEIVLK
MTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINR
A
KGLK
HVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDP
T
QIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWP
QLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYII
L
IAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQ
RQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYF
E
YLMFALIMLNTICLGMQ
HYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIV
I
GSIIDVILSEID
DPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFF
I
YAVIGMQ
MFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEE
H
TCGTNFAYYYFISFYMLCAFL
IINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKH
L
DVVTLLRRIQPPLGFGKFCPHRVACK
RLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEE
L
RAIIKKIWKRTSMKLLDQVIPPIG
DDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGL
R
TIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFR
RTGGLFGQVDNFLERTNSLPPVMANQRPLQ
F
AEIEMEELESPVFLEDFPQNPGTHPLARANTNNANANVAYGNSSHRNNPVFS
SICYEREFLGEADMPVT
R
EGPLSQPCRAS
GPHSRSHVDKLKRPMTQRGMPEGQVPPSPCQLSQAEHPVQKEGKGPTSRFLETPNSRN
F
EEHVPRNSAHRCTAPATAMLIQE
ALVRGGLDSLAADANFVMATGQALADACQMEPEEVEVAATELLKQE
S
PEGGAVPWEP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser