NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48310.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48310.1 Public Mus musculus 1 Inpp5d 16 104 75 CCDS HistoryNCBI Gene:16331Re-query CCDS DB by CCDS ID:48310.1Re-query CCDS DB by GeneID:16331

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48310.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000168783 ENSMUSP00000131244 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168783Link to Ensembl Protein Viewer:ENSMUSP00000131244Re-query CCDS DB by Nucleotide ID:ENSMUST00000168783Re-query CCDS DB by Protein ID:ENSMUSP00000131244
Original member Current member EBI,WTSI OTTMUST00000091935 OTTMUSP00000050701 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091935Link to Vega Protein Viewer:OTTMUSP00000050701Re-query CCDS DB by Nucleotide ID:OTTMUST00000091935Re-query CCDS DB by Protein ID:OTTMUSP00000050701
Original member NCBI NM_001110193.1 NP_001103663.1 Updated not alive Link to Nucleotide Sequence:NM_001110193.1Link to Protein Sequence:NP_001103663.1Re-query CCDS DB by Nucleotide ID:NM_001110193Re-query CCDS DB by Protein ID:NP_001103663
Current member NCBI NM_001110193.2 NP_001103663.1 Accepted alive Link to Nucleotide Sequence:NM_001110193.2Link to Protein Sequence:NP_001103663.1Re-query CCDS DB by Nucleotide ID:NM_001110193Re-query CCDS DB by Protein ID:NP_001103663Link to BLink:NP_001103663.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103663.1 1130 Q9ES52-3 1130 100% 0 0

Chromosomal Locations for CCDS 48310.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 87620489 87620631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87635292 87635355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87665387 87665537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87667889 87668063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87669642 87669782 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87676283 87676370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87681489 87681569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87681687 87681758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87683743 87683866 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87691625 87691731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87695333 87695435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87697349 87697545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87698113 87698230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87699028 87699124 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87699640 87699778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87701160 87701268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87701415 87701503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87703118 87703199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87705934 87706023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87708096 87708209 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87709618 87709700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87711065 87711152 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87712031 87712180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87713193 87713289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87715038 87715093 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87715277 87715313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87717690 87718284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87719321 87719323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3393 nt):
ATGCCTGCCATGGTCCCTGGGTGGAACCATGGCAACATCACCCGCTCCAAGGCAGAGGAGCTACTTTCCA
GA
GCCGGCAAGGACGGGAGCTTCCTTGTGCGTGCCAGCGAGTCCATCCCCCGGGCCTACGCACTCTGCGT
G
CTGTTCCGGAATTGTGTTTACACTTACAGGATTCTGCCCAATGAGGACGATAAATTCACTGTTCAGGCA
TCC
GAAGGTGTCCCCATGAGGTTCTTCACGAAGCTGGACCAGCTCATCGACTTTTACAAGAAGGAAAACA
TG
GGGCTGGTGACCCACCTGCAGTACCCCGTGCCCCTGGAGGAGGAGGATGCTATTGATGAGGCTGAGGA
G
GACACTGTAGAAAGTGTCATGTCACCACCTGAGCTGCCTCCCAGAAACATTCCTATGTCTGCCGGGCCC
AGC
GAGGCCAAGGACCTTCCTCTTGCAACAGAGAACCCCCGAGCCCCTGAGGTCACCCGGCTGAGTCTCT
CC
GAGACACTGTTTCAGCGTCTACAGAGCATGGATACCAGTGGGCTTCCCGAGGAGCACCTGAAAGCCAT
C
CAGGATTATCTGAGCACTCAGCTCCTCCTGGATTCCGACTTTTTGAAGACGGGCTCCAGCAACCTCCCT
CAC
CTGAAGAAGCTGATGTCACTGCTCTGCAAGGAGCTCCATGGGGAAGTCATCAGGACTCTGCCATCCC
TG
GAGTCTCTGCAGAGGTTGTTTGACCAACAGCTCTCCCCAGGCCTTCGCCCACGACCTCAGGTGCCCGG
A
GAGGCCAGTCCCATCACCATGGTTGCCAAACTCAGCCAATTGACAAGTCTGCTGTCTTCCATTGAAGAT
AAG
GTCAAGTCCTTGCTGCACGAGGGCTCAGAATCTACCAACAGGCGTTCCCTTATCCCTCCGGTCACCT
TT
GAGGTGAAGTCAGAGTCCCTGGGCATTCCTCAGAAAATGCATCTCAAAGTGGACGTTGAGTCTGGGAA
A
CTGATCGTTAAGAAGTCCAAGGATGGTTCTGAGGACAAGTTCTACAGCCACAAAAAAATCCTGCAGCTC
ATT
AAGTCCCAGAAGTTTCTAAACAAGTTGGTGATTTTGGTGGAGACGGAGAAGGAGAAAATCCTGAGGA
AG
GAATATGTTTTTGCTGACTCTAAGAAAAGAGAAGGCTTCTGTCAACTCCTGCAGCAGATGAAGAACAA
G
CATTCGGAGCAGCCAGAGCCTGACATGATCACCATCTTCATTGGCACTTGGAACATGGGTAATGCACCC
CCT
CCCAAGAAGATCACGTCCTGGTTTCTCTCCAAGGGGCAGGGAAAGACACGGGACGACTCTGCTGACT
AC
ATCCCCCATGACATCTATGTGATTGGCACCCAGGAGGATCCCCTTGGAGAGAAGGAGTGGCTGGAGCT
A
CTCAGGCACTCCCTGCAAGAAGTCACCAGCATGACATTTAAAACAGTTGCCATCCACACCCTCTGGAAC
ATT
CGCATAGTGGTGCTTGCCAAGCCAGAGCATGAGAATCGGATCAGCCATATCTGCACTGACAACGTGA
AG
ACAGGCATCGCCAACACCCTGGGAAACAAGGGAGCAGTGGGAGTGTCCTTCATGTTCAATGGAACCTC
C
TTGGGGTTCGTCAACAGCCACTTGACTTCTGGAAGTGAAAAAAAGCTCAGGAGAAATCAAAACTATATG
AAC
ATCCTGCGGTTCCTGGCCCTGGGAGACAAGAAGCTAAGCCCATTTAACATCACCCACCGCTTCACCC
AC
CTCTTCTGGCTTGGGGATCTCAACTACCGCGTGGAGCTGCCCACTTGGGAGGCAGAGGCCATCATCCA
G
AAGATCAAGCAACAGCAGTATTCAGACCTTCTGGCCCACGACCAACTGCTCCTGGAGAGGAAGGACCAG
AAG
GTCTTCCTGCACTTTGAGGAGGAAGAGATCACCTTCGCCCCCACCTATCGATTTGAAAGACTGACCC
GG
GACAAGTATGCATACACGAAGCAGAAAGCAACAGGGATGAAGTACAACTTGCCGTCCTGGTGCGACCG
A
GTCCTCTGGAAGTCTTACCCGCTGGTGCATGTGGTCTGTCAGTCCTATGGCAGTACCAGTGACATCATG
ACG
AGTGACCACAGCCCTGTCTTTGCCACGTTTGAAGCAGGAGTCACATCTCAATTCGTCTCCAAGAATG
GT
CCTGGCACTGTAGATAGCCAAGGGCAGATCGAGTTTCTTGCATGCTACGCCACACTGAAGACCAAGTC
C
CAGACTAAGTTCTACTTGGAGTTCCACTCAAGCTGCTTAGAGAGTTTTGTCAAGAGTCAGGAAGGAGAG
AAT
GAAGAGGGAAGTGAAGGAGAGCTGGTGGTACGGTTTGGAGAGACTCTTCCCAAGCTAAAGCCCATTA
TC
TCTGACCCCGAGTACTTACTGGACCAGCATATCCTGATCAGCATTAAATCCTCTGACAGTGACGAGTC
C
TATGGTGAAGGCTGCATTGCCCTTCGCTTGGAGACCACAGAGGCTCAGCATCCTATCTACACGCCTCTC
ACC
CACCATGGGGAGATGACTGGCCACTTCAGGGGAGAGATTAAGCTGCAGACCTCCCAGGGCAAGATGA
GG
GAGAAGCTCTATGACTTTGTGAAGACAGAGCGGGATGAATCCAGTGGAATGAAATGCTTGAAGAACCT
C
ACCAGCCATGACCCTATGAGGCAATGGGAGCCTTCTGGCAGGGTCCCTGCATGTGGTGTCTCCAGCCTC
AAT
GAGATGATCAATCCAAACTACATTGCCAACCGAGGTCCCTGCCCCAGGGTGCAAGAGGCAAGACCTG
GG
GATCTGGGAAAGGTGGAAGCTCTGCTCCAGGAGGACCTGCTGCTGACGAAGCCCGAGATGTTTGAGAA
C
CCACTGTATGGATCCGTGAGTTCCTTCCCTAAGCTGGTGCCCAGGAAAGAGCAGGAGTCTCCCAAGATG
CTG
CGGAAGGAGCCCCCGCCCTGTCCAGACCCAGGAATCTCATCACCCAGCATCGTGCTCCCCAAAGCCC
AA
GAGGTGGAGAGTGTCAAGGGGACAAGCAAACAGGCCCCTGTGCCTGTCCTTGGCCCCACACCCCGGAT
C
CGCTCCTTTACCTGTTCTTCTTCTGCTGAGGGCAGAATGACCAGTGGGGACAAGAGCCAAGGGAAGCCC
AAG
GCCTCAGCCAGTTCCCAAGCCCCAGTGCCAGTCAAGAGGCCTGTCAAGCCTTCCAGGTCAGAAATGA
GC
CAGCAGACAACACCCATCCCAGCTCCACGGCCACCCCTGCCAGTCAAGAGTCCTGCTGTCCTGCAGCT
G
CAACATTCCAAAGGCAGAGACTACCGTGACAACACAGAACTCCCCCACCATGGCAAGCACCGCCAAGAG
GAG
GGGCTGCTTGGCAGGACTGCCATGCAGTGA


Translation (1130 aa):
MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYALCVLFRNCVYTYRILPNEDDKFTVQA
S
EGVPMRFFTKLDQLIDFYKKENMGLVTHLQYPVPLEEEDAIDEAEEDT
VESVMSPPELPPRNIPMSAGP
S
EAKDLPLATENPRAPEVTRLSLSETLFQRLQSMDTS
GLPEEHLKAIQDYLSTQLLLDSDFLKTGSSNLP
H
LKKLMSLLCKELH
GEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPITMVAKLSQLTSLLSSIED
K
VKSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKVDVESGKLIVKKSKDGSEDKFYSHKKILQL
I
KSQKFLNKLVILVETEKEKILRKEYVFADSK
KREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAP
P
PKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKEWLELLRHSLQEVTSMTFKT
VAIHTLWN
I
RIVVLAKPEHENRISHICTDNVKTGIANTL
GNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYM
N
ILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTW
EAEAIIQKIKQQQYSDLLAHDQLLLERKDQ
K
VFLHF
EEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIM
T
SDHSPVFATFEAGVTSQFVSKN
GPGTVDSQGQIEFLACYATLKTKSQTKFYLEFHSSCLESFVKSQEGE
N
EEGSEGELVVRFGETLPK
LKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLETTEAQHPIYTPL
T
HHGEMTGHFRGEIKLQTSQGKMREKLY
DFVKTERDESSGMKCLKNLTSHDPMRQWEPSGRVPACGVSSL
N
EMINPNYI
ANRGPCPRVQEARPGDLGKVEALLQEDLLLTKPEMFENPLYGSVSSFPKLVPRKEQESPKM
L
RKEPPPCPDPGISSPSIVLPKAQEVESVKGTSKQAPVPVLGPTPRIRSFTCSSSAEGRMTSGDKSQGKP
K
ASASSQAPVPVKRPVKPSRSEMSQQTTPIPAPRPPLPVKSPAVLQLQHSKGRDYRDNTELPHHGKHRQE
E
GLLGRTAMQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser