NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40970.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40970.1 Public Mus musculus X Hs6st2 16 104 75 CCDS HistoryNCBI Gene:50786Re-query CCDS DB by CCDS ID:40970.1Re-query CCDS DB by GeneID:50786

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 40970.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000088172 ENSMUSP00000085497 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000088172Link to Ensembl Protein Viewer:ENSMUSP00000085497Re-query CCDS DB by Nucleotide ID:ENSMUST00000088172Re-query CCDS DB by Protein ID:ENSMUSP00000085497
Original member Current member EBI,WTSI OTTMUST00000042462 OTTMUSP00000019086 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042462Link to Vega Protein Viewer:OTTMUSP00000019086Re-query CCDS DB by Nucleotide ID:OTTMUST00000042462Re-query CCDS DB by Protein ID:OTTMUSP00000019086
Original member NCBI NM_001077202.1 NP_001070670.1 Updated not alive Link to Nucleotide Sequence:NM_001077202.1Link to Protein Sequence:NP_001070670.1Re-query CCDS DB by Nucleotide ID:NM_001077202Re-query CCDS DB by Protein ID:NP_001070670
Current member NCBI NM_001077202.2 NP_001070670.1 Accepted alive Link to Nucleotide Sequence:NM_001077202.2Link to Protein Sequence:NP_001070670.1Re-query CCDS DB by Nucleotide ID:NM_001077202Re-query CCDS DB by Protein ID:NP_001070670Link to BLink:NP_001070670.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001070670.1 652 Q80UW0-3 652 100% 0 0

Chromosomal Locations for CCDS 40970.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 51389470 51390361 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 51428658 51428744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 51471374 51471406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 51679890 51680408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 51681175 51681602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1959 nt):
ATGGCACTGCCTGCGTTTGCAGCCCGGGCGCTCGGGCCGCCACTGCAACCGGAGCAAGGAGCGCCCGCCC
GC
ACCACCTGTCCCCGCCGGCATTCCAGAGTAGAGGCCGAATTGGCAGCAAGCCGGCCCGGGTCTGTTGC
C
GCCTCAGTCCGCGCCGGCCCTCCTAGGGGTGTGTCTCTCGGATTCAACTCCCCGCCGCTCCAGGACAAG
CCC
CCAAAGGCATTTTCTTCCTTGGCGGGAGCCTTGCGCGCCCCGCTCTTCGCGCTGCTGCCTCGAGGCC
GC
CGCAGGCGGATGCACGACCTCAGGCGACGCTGGGACCTGGGCTCCCTCTGCCGGGCCCTGCTCACTCG
G
GGCCTGGCAGCCGTGGGCCACTCGCTCAAGCACGTGCTCAGTGCGATCTTCTCCAAGATTTTCGGTCCC
TTG
GCCAGCGTCGGGAACATGGATGAGAAATCTAACAAGCTGCTGCTGGCTTTGGTGATGCTCTTCCTAT
TT
GCGGTGATCGTCCTCCAATACGTGTGCCCCGGCACAGAATGCCAGCTCCTCCGCCTGCAGGCGTTCAG
C
TCCCCGGTGCCGGATCCGTACCGCTCGGAGGATGAGAGTTCGGCCAGGTTTGTACCCCGCTACAATTTC
AGC
CGCGGCGATCTCCTGCGCAAGGTAGACTTCGACATCAAGGGCGATGACCTGATCGTGTTCCTGCACA
TC
CAGAAGACTGGGGGCACCACTTTTGGCCGTCACCTGGTGCGCAACATCCAGCTGGAGCAGCCATGTGA
G
TGCCGCGTGGGGCAGAAGAAATGCACTTGCCACCGGCCGGGTAAGAGGGAGACCTGGCTCTTCTCCAGG
TTC
TCCACCGGCTGGAGCTGCGGGCTGCATGCCGACTGGACCGAGCTCACCAGCTGCGTGCCGGCGGTGG
TG
GATGGCAAGCGCGACGCCAGGCTGAGACCTTCCAGGTGGAGGATTTTTCAGATTCTAGATGGAACAAG
T
AAGGATAGATGGGGTTCTTCAAACTTCAACTCAGGCGCCAACTCTCCATCCTCCACAAAGCCCCGGAGC
ACA
TCGAAGAGTGGGAAGAACTTCCATTACATTACCATCCTGAGAGACCCAGTGTCACGGTACTTGAGTG
AA
TGGAGGCATGTCCAGAGAGGAGCAACTTGGAAAGCATCCCTGCACGTCTGTGATGGAAGGCCCCCAAC
C
TCTGAAGAGCTGCCCAGCTGCTACACCGGTGATGACTGGTCTGGATGCCCTCTCAAAGAGTTCATGGAC
TGT
CCCTATAATCTGGCCAACAACCGCCAAGTTCGCATGCTATCTGACCTGACTCTAGTGGGATGCTACA
AC
CTCTCTGTCATGCCTGAAAAGCAAAGAAACAAAGTCCTTCTGGAAAGTGCCAAATCCAATCTGAAGCA
C
ATGGCGTTCTTTGGCCTCACTGAGTTTCAGCGCAAGACCCAGTACCTGTTTGAGAAGACCTTCAACATG
AAC
TTTATCTCGCCGTTTACCCAGTATAATACCACTAGGGCCTCTAGTGTTGAGATCAATGAGGAAATCC
AA
AAGCGTATTGAGGGACTGAATTTTCTGGATATGGAGTTGTACAGCTATGCTAAAGACCTCTTTCTGCA
A
AGGTATCAGTTCATGAGGCAGAAAGAACATCAGGATGCCAGGCGGAAGCGTCAGGAGCAACGCAAATTT
CTG
AAGGGAAGGTTCCTTCAGACCCATTTCCAGAGTCAGAGTCAGGGTCAGAGCCAGAGCCAGAGTCCAG
GT
CAGAATCTGAGTCAGAATCCAAATCCTAACCCAAATCAGAACCTGACTCAGAACCTGAGTCACAATCT
G
ACTCCGAGTTCAAATCCCAATTCGACCCAGAGGGAGAACCGGGGAAGTCAGAAGCAGGGCTCAGGCCAG
GGA
CAAGGTGATAGCGGCACCAGCAATGGCACCAATGACTACATAGGGAGCGTAGAGACATGGCGCTAA


Translation (652 aa):
MALPAFAARALGPPLQPEQGAPARTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSLGFNSPPLQDK
P
PKAFSSLAGALRAPLFALLPRGRRRRMHDLRRRWDLGSLCRALLTRGLAAVGHSLKHVLSAIFSKIFGP
L
A
SVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVPRYNF
S
RGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSR
F
STGWSCGLHADWTELTSCVPAVVDGKRDARLRPS
RWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRS
T
SKSG
KNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMD
C
PYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNM
N
FISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQDARRKRQEQRKF
L
KGRFLQTHFQSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQRENRGSQKQGSGQ
G
QGDSGTSNGTNDYIGSVETWR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser