NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40817.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40817.1 Public Mus musculus 9 Slc6a20a 16 104 75 CCDS HistoryNCBI Gene:102680Re-query CCDS DB by CCDS ID:40817.1Re-query CCDS DB by GeneID:102680

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 40817.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040960 ENSMUSP00000047690 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040960Link to Ensembl Protein Viewer:ENSMUSP00000047690Re-query CCDS DB by Nucleotide ID:ENSMUST00000040960Re-query CCDS DB by Protein ID:ENSMUSP00000047690
Original member Current member EBI,WTSI OTTMUST00000092800 OTTMUSP00000051356 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000092800Link to Vega Protein Viewer:OTTMUSP00000051356Re-query CCDS DB by Nucleotide ID:OTTMUST00000092800Re-query CCDS DB by Protein ID:OTTMUSP00000051356
Original member Current member NCBI NM_139142.2 NP_631881.1 Accepted alive Link to Nucleotide Sequence:NM_139142.2Link to Protein Sequence:NP_631881.1Re-query CCDS DB by Nucleotide ID:NM_139142Re-query CCDS DB by Protein ID:NP_631881Link to BLink:NP_631881.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_631881.1 592 Q8VDB9 592 100% 0 0

Chromosomal Locations for CCDS 40817.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

Chromosome Start Stop Links
9 123636996 123637145 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123637793 123637958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123640568 123640727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123641710 123641914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123655003 123655165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123656221 123656462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123657402 123657512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123660395 123660622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123662949 123663040 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123664553 123664693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 123678686 123678806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1779 nt):
ATGGAGAAGGCACGGCCTCAGTGGGGCCATCCGCTGCAGTTCGTGTTCGCCTGCATCTCCTACGCCGTGG
GT
TTGGGCAACGTGTGGCGCTTCCCTTACCTGTGCCAGATGTACGGCGGAGGGAGTTTCCTGGTCCCCTA
C
ATCATCATGCTCATTGTGGAGGGGATGCCACTCCTGTACCTGGAGCTGGCCGTGGGACAGCGCATGCGG
CAG
GGCAGCATTGGTGCCTGGAGGACCATCAGCCCCTACCTCAGTGGTGTCGGTGTTGCCAGTGTTGTGG
TC
TCCTTCTTCCTCTCCATGTACTACAATGTCATCAATGCCTGGGGCTTCTGGTACCTCTTCCACTCCTT
C
CAGGATCCCCTGCCGTGGTCTGTCTGCCCACTGAACAGCAACCACACAGGCTACGATGAGGAGTGTGAG
AAG
GCTTCGTCGACACAGTACTTCTGGTACAGGAAAACACTCAACATCTCACCGTCCATCCAGGAGAATG
GA
GGAGTGCAGTGGGAGCCAGCGCTGTGCCTCACCCTGGCCTGGCTGATGGTCTATCTGTGCATCCTGAG
A
GGCACCGAATCTACTGGCAAGGTGGTCTACTTCACCGCATCGATGCCTTACTGTGTTCTTATTATCTAC
TTG
GTCCGTGGCCTTACACTCCATGGAGCCACCAATGGCCTGATGTACATGTTCACACCTAAGATGGAAC
AG
CTAGCCAACCCCAAGGCCTGGATCAATGCAGCCACGCAGATCTTCTTCTCACTGGGCTTGGGTTTTGG
C
AGCCTGATCGCTTTTGCCAGCTACAATGAACCCTCCAACAACTGCCAGAAGCATGCCATTATTGTGTCC
ATC
ATCAACAGCTCCACCTCCATATTTGCCAGCATTGTCACCTTCTCCATCTATGGCTTCAAGGCCACCT
TC
AACTATGAAAACTGCTTAAACAAGGTGATTCTGCTGCTGACCAATTCTTTTGACCTTGAAGATGGCTT
T
CTGACAGTCAGCAACCTGGAGGAGGTGAAGAACTACCTGGCATCTACTTACCCAAACAAGTACAGTGAA
GTG
TTCCCACACATTAGAAACTGCAGCTTGGAATCAGAGCTGGACACGGCTGTCCAGGGCACAGGCCTGG
CC
TTCATCGTCTACACTGAGGCCATTAAAAACATGGAAGTTTCCCAGCTCTGGTCAGTGCTCTACTTCTT
C
ATGCTGCTGATGCTGGGTATCGGAAGCATGCTTGGAAACACAGCGGCCATCCTCACCCCTCTGACTGAC
AGC
AAGGTCATCTCCAGCTACCTGCCCAAGGAGGCCATTTCAGGTTTGGTATGCCTCATCAACTGTGCTG
TT
GGCATGGTGTTCACCATGGAGGCTGGGAACTACTGGTTTGACATATTCAATGACTATGCGGCCACCCT
G
TCTCTGCTGCTCATTGTGCTGGTAGAGACCATAGCTGTGTGCTATGTGTATGGGCTGAAGAGATTTGAA
AGT
GACCTTCGGGCCATGACTGGCCGCACCCTCAGCTGGTACTGGAAGGTCATGTGGGCGTTTGTGAGTC
CA
CTGCTCATCGTCGGCCTCTTTATCTTCTACCTGAGTGACTACATCCTCACGGGAACACTGCAGTACCA
A
GCCTGGGATGCTACTCAGGGGCAGTTGGTGACCAAGGATTACCCCCCACATGCGCTAGCTGTCATCGGT
TTG
CTGGTGGCTTCATCTACCATGTGCATCCCCCTGGTGGCCCTGGGGACTTTCATCAGGAATCGCCTCA
AG
AGGGGAGGCTCTGCCCCAGTGGCCTAA


Translation (592 aa):
MEKARPQWGHPLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLELAVGQRMR
Q
GSIGAWRTISPYLSGV
GVASVVVSFFLSMYYNVINAWGFWYLFHSFQDPLPWSVCPLNSNHTGYDEECE
K
ASSTQYFWYRKTLNISPSIQENGGVQWEPALCLTLAWLMVYLCILRGTESTGK
VVYFTASMPYCVLIIY
L
VRGLTLHGATNGLMYMFTPK
MEQLANPKAWINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVS
I
INSSTSIFASIVTFSIYGFKATFNYENCLN
KVILLLTNSFDLEDGFLTVSNLEEVKNYLASTYPNKYSE
V
FPHIRNCSLESELDT
AVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
S
KVISSYLPKEAIS
GLVCLINCAVGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAVCYVYGLKRFE
S
DLRAMTGRTLSWYWKVMWAFVSPLLIVGLFIFYLSDYILTGTLQYQAWDATQ
GQLVTKDYPPHALAVIG
L
LVASSTMCIPLVALGTFIRNRLKRGGSAPVA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser