NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40594.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40594.1 Public Mus musculus 9 Sorl1 16 104 75 CCDS HistoryNCBI Gene:20660Re-query CCDS DB by CCDS ID:40594.1Re-query CCDS DB by GeneID:20660See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 40594.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060989 ENSMUSP00000058613 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060989Link to Ensembl Protein Viewer:ENSMUSP00000058613Re-query CCDS DB by Nucleotide ID:ENSMUST00000060989Re-query CCDS DB by Protein ID:ENSMUSP00000058613
Original member Current member EBI,WTSI OTTMUST00000078792 OTTMUSP00000041931 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078792Link to Vega Protein Viewer:OTTMUSP00000041931Re-query CCDS DB by Nucleotide ID:OTTMUST00000078792Re-query CCDS DB by Protein ID:OTTMUSP00000041931
Original member Current member NCBI NM_011436.3 NP_035566.2 Accepted alive Link to Nucleotide Sequence:NM_011436.3Link to Protein Sequence:NP_035566.2Re-query CCDS DB by Nucleotide ID:NM_011436Re-query CCDS DB by Protein ID:NP_035566Link to BLink:NP_035566.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035566.2 2215 O88307 2215 100% 0 0

Chromosomal Locations for CCDS 40594.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 41968603 41968670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41969644 41969856 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41973937 41974129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41976358 41976464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41977436 41977610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41979330 41979494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41980626 41980745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41982906 41983090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41984436 41984535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41985558 41985640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41987466 41987538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41988705 41988809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41989354 41989466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41991312 41991481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41991619 41991745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41992304 41992435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 41996171 41996320 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42000244 42000399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42001471 42001605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42002554 42002685 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42003986 42004117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42005806 42005913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42008179 42008304 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42014455 42014574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42018116 42018238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42022336 42022449 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42024296 42024469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42030879 42031017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42031669 42031915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42033565 42033656 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42035443 42035574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42037049 42037221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42040993 42041078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42041564 42041692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42043907 42044093 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42046483 42046661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42057271 42057359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42063715 42063788 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42063987 42064104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42067797 42067989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42071072 42071241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42072245 42072346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42081788 42081968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42089945 42090012 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42092309 42092470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42099145 42099270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42106428 42106544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 42123829 42124113 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6648 nt):
ATGGCGACACGGAGCAGCAGGAGGGAGTCGAGACTCCCTTTCCTATTCGCCCTGGTCGCGCTGCTACCCC
GC
GGGGCTCTCGGCGGGGGCTGGACGCAGAGATTGCACGGTGGCCCGGCGCCCTTGCCCCAGGACCGGGG
C
TTCTTCGTGGTGCAGGGCGACCCGCGCGATCTCCGGCTAGGAACGCACGGGGATGCCCCGGGGGCGAGC
CCG
GCGGCCAGGAAGCCACTCAGGACCCGGCGGAGCGCTGCTCTGCAGCCCCAGCCTATCCAGGTGTATG
GA
CAGGTCAGTCTGAATGACTCCCACAATCAGATGGTGGTGCACTGGGCCGGAGAGAAAAGCAACGTGAT
C
GTGGCATTAGCCCGAGACAGCCTGGCGTTGGCAAGGCCCAAGAGCAGTGATGTGTATGTGTCTTACGAC
TAT
GGAAAATCATTCAGTAAGATTTCAGAGAAGCTGAACTTTGGCGTGGGCAACAACAGCGAAGCTGTGA
TC
TCCCAGTTCTACCACAGCCCTGCTGACAACAAGAGGTACATCTTTGTGGATGCTTACGCCCAATACCT
C
TGGATCACATTTGACTTCTGCAGCACTATCCATGGCTTCTCCATCCCATTCCGGGCGGCTGATCTCCTC
CTC
CATAGCAAGGCCTCCAACCTCCTCTTGGGCTTTGACAGGTCTCACCCCAACAAGCAGCTATGGAAGT
CA
GATGATTTTGGCCAGACCTGGATCATGATTCAGGAACACGTGAAGTCCTTCTCTTGGGGAATCGACCC
C
TATGATCAGCCAAACGCTATCTACATTGAGCGACATGAACCCTTTGGGTTCTCCACAGTGCTCCGCAGT
ACA
GACTTCTTCCAGTCCCGGGAAAACCAGGAAGTGATCCTGGAGGAAGTGAGAGACTTTCAGCTTCGCG
AC
AAGTATATGTTTGCTACAAAGGTGGTGCATCTTCCGGGCAGCCAGCAGCAGTCATCTGTCCAGCTCTG
G
GTCTCCTTTGGCCGGAAGCCTATGAGAGCAGCCCAGTTTGTCACAAAGCATCCTATTAATGAATATTAC
ATC
GCTGATGCCGCCGAGGACCAGGTGTTCGTGTGTGTTAGCCACAGTAACAACAGCACTAACTTATACA
TC
TCAGAGGCAGAGGGGCTGAAGTTCTCCCTCTCCTTGGAGAATGTGCTGTATTACAGCCCAGGAGGGGC
C
GGCAGTGACACTCTGGTGAGGTATTTTGCAAATGAGCCGTTTGCCGACTTTCACCGCGTGGAAGGCTTA
CAA
GGAGTCTATATTGCCACCCTGATTAATGGTTCTATGAATGAGGAGAACATGAGGTCGGTCATCACCT
TT
GACAAAGGGGGAACCTGGGAATTTCTTCAGGCCCCAGCCTTCACAGGATATGGAGAGAAAATCAATTG
T
GAGCTTTCTCAGGGTTGTTCCCTCCACCTGGCCCAGCGCCTCAGTCAACTGCTCAACCTCCAACTTCGG
AGG
ATGCCTATCCTATCCAAGGAGTCAGCCCCCGGTCTCATCATTGCTACCGGCTCTGTGGGAAAGAACT
TG
GCCAGCAAGACCAATGTGTACATCTCTAGCAGTGCTGGAGCCAGGTGGAGAGAGGCTCTTCCCGGACC
T
CATTACTATACTTGGGGTGACCATGGAGGCATCATCATGGCGATTGCCCAGGGCATGGAGACCAACGAG
CTG
AAGTACAGCACCAATGAAGGGGAGACCTGGAAGACGTTCGTCTTCTCGGAGAAGCCTGTGTTTGTGT
AT
GGGCTTCTCACAGAACCTGGTGAGAAGAGCACCGTCTTCACCATCTTCGGCTCGAACAAGGAGAGTGT
C
CACAGCTGGCTCATCCTGCAGGTCAATGCCACTGATGCCTTGGGGGTTCCTTGCACAGAAAACGACTAC
AAG
CTGTGGTCCCCATCTGATGAGCGAGGAAATGAGTGTTTGCTAGGACACAAGACAGTTTTCAAAAGGA
GG
ACCCCTCATGCCACGTGCTTTAATGGGGAAGACTTTGACCGGCCAGTGGTTGTGTCCAACTGCTCCTG
C
ACCCGGGAGGACTACGAATGTGACTTTGGCTTCAAGATGAGCGAAGATCTCTCCTTAGAGGTTTGTGTT
CCA
GACCCTGAGTTTTCTGGGAAGCCCTACAGCCCTCCTGTGCCTTGTCCTGTGGGTTCTTCATACAGGA
GA
ACGAGAGGCTATCGGAAGATTTCTGGGGATACGTGCAGTGGAGGAGACGTTGAAGCGCGGCTGGAAGG
G
GAGCTGGTCCCCTGTCCCCTTGCAGAAGAGAATGAGTTCATCCTATACGCCATGCGCAAGTCCATCTAC
CGC
TACGACTTGGCCTCGGGAGCCACAGAGCAGCTTCCTCTCTCGGGGCTGCGGGCGGCTGTGGCCCTGG
AC
TTTGACTATGAACGCAACTGCTTGTATTGGTCTGACCTGGCGCTGGACACCATCCAGCGTCTCTGCTT
G
AACGGGAGCACAGGGCAGGAGGTGATCATCAATTCCGGCCTGGAGACCGTGGAGGCTTTGGCCTTCGAA
CCC
CTCAGCCAATTACTTTACTGGGTGGATGCCGGCTTTAAAAAGATCGAGGTAGCTAATCCAGATGGTG
AC
TTCCGACTGACAATCGTCAATTCCTCTGTGCTTGATCGACCCAGGGCTTTAGTCCTTGTACCCCAAGA
A
GGGGTGATGTTCTGGACTGACTGGGGGGACCTGAAGCCTGGGATTTACCGGAGCTACATGGACGGCTCT
GCT
GCCTACCGCCTTGTGTCAGAGGACGTGAAGTGGCCCAATGGCATCTCTGTGGACAGCCAGTGGATCT
AC
TGGACGGATGCTTACCTGGACTGTATCGAGCGCATCACTTTCAGTGGCCAGCAGCGTTCAGTCATCCT
T
GACAGCCTCCCACACCCCTATGCCATCGCTGTCTTTAAGAATGAGATCTACTGGGATGACTGGTCACAG
CTC
AGCATCTTCAGAGCTTCGAAGCACAGCAGATCCCAGGTGGAGATTCTAGCAAGCCAGCTCACGGGCC
TC
ATGGACATGAAGGTTTTCTACAAGGGAAAGAATGCTGGAAGCAACGCTTGTGTCCCTCAGCCCTGCAG
T
CTACTGTGCCTCCCTAAGGCCAACAACAGCAAAAGCTGCAGGTGTCCAGAAGGTGTGGCCAGCAGTGTC
CTC
CCCTCTGGGGACCTGATGTGTGACTGCCCTCAGGGCTATCAAAGGAAGAACAACACCTGTGTCAAAG
AA
GAGAACACCTGTCTCCGAAACCAGTATCGCTGCAGCAACGGCAACTGTATCAACAGCATTTGGTGGTG
T
GATTTCGACAATGACTGTGGAGACATGAGTGACGAGAGAAATTGCCCCACGACGGTCTGTGATGCAGAC
ACT
CAGTTCCGGTGCCAGGAGTCGGGGACTTGCATTCCACTCTCCTATAAGTGTGACCTTGAAGATGACT
GT
GGAGATAACAGTGATGAGAGTCACTGTGAGATGCACCAGTGTCGTAGCGACGAGTTCAACTGCAGCTC
T
GGGATGTGCATCCGGTCCTCCTGGGTGTGCGATGGAGACAACGACTGTAGGGACTGGTCTGATGAAGCC
AAC
TGTACTGCCATCTATCATACCTGTGAGGCCTCCAACTTCCAGTGCCACAATGGCCACTGCATCCCCC
AG
CGATGGGCATGTGACGGTGATGCGGATTGCCAGGATGGCTCTGACGAAGATCCCGTCAGCTGTGAGAA
A
AAGTGCAATGGATTCCACTGCCCAAACGGCACGTGCATCCCGTCCAGCAAGCATTGTGATGGGCTGAGG
GAC
TGCCCCGACGGCTCCGATGAGCAGCACTGTGAGCCCTTCTGCACGCGCTTCATGGACTTCGTGTGTA
AG
AACCGTCAGCAGTGTCTGTTCCACTCCATGGTGTGTGACGGGATCGTCCAGTGCCGAGATGGCTCTGA
T
GAGGATGCGGCCTTCGCTGGATGCTCGCAAGACCCCGAGTTCCACAAGGAGTGCGATGAGTTCGGCTTC
CAG
TGTCAGAACGGAGTGTGCATCAGCTTGATTTGGAAATGCGATGGGATGGATGACTGCGGGGACTACT
CT
GACGAGGCCAACTGTGAAAACCCCACGGAAGCCCCAAACTGTTCCCGTTACTTTCAGTTCCACTGTGA
G
AATGGCCACTGCATCCCCAACAGGTGGAAATGTGACAGAGAGAACGACTGTGGGGACTGGTCTGATGAG
AAG
GATTGTGGAGATTCACATGTTCTACCCTCCCCGACCCCCGGGCCCTCCACGTGTCTGCCCAATTACT
TC
CACTGCAGCAGCGGGGCCTGTGTGATGGGCACCTGGGTGTGCGACGGCTACAGGGACTGTGCAGATGG
C
TCTGATGAGGAGGCCTGCCCCTCTCTAGCAAACTCCACTGCCGCCTCCACTCCCACCCAGTTCGGGCAG
TGC
GACCGATTTGAGTTCGAGTGTCACCAACCAAAGAAATGTATCCCCAACTGGAAGCGCTGTGACGGCC
AC
CAAGATTGCCAAGACGGCCAGGATGAAGCCAACTGCCCCACTCACAGCACCTTGACCTGTACGAGCAG
G
GAGTTCAAGTGTGAGGACGGCGAGGCATGCATCGTGCTCTCGGAGCGCTGTGATGGCTTCCTGGATTGC
TCT
GATGAGAGCGATGAGAAGGCCTGCAGCGATGAGTTAACTGTATACAAAGTGCAGAATCTCCAGTGGA
CA
GCTGATTTCTCCGGAGATGTGACTTTGACCTGGATGCGGCCAAAGAAAATGCCATCTGCTTCTTGTGT
A
TACAATGTCTACTACAGGGTGGTTGGAGAGAGCATATGGAAGACCCTGGAAACCCACAGCAATAAAACA
AGC
ACTGTGCTCAAGGTCCTGAAGCCAGACACCACGTACCAGGTTAAGGTCCAGGTGCACTGCCTCAACA
AG
GTGCACAACACCAATGACTTTGTGACCCTCAGGACTCCAGAAGGGTTGCCAGATGCCCCTCGGAATCT
C
CAGCTCTCCCTGAACAGTGAAGAGGAAGGTGTGATTCTCGGGCACTGGGCTCCTCCCGTCCACACCCAT
GGC
CTCATCCGTGAGTACATTGTGGAATACAGCAGGAGTGGGTCCAAGATGTGGGCCTCCCAGAGAGCTG
CT
AGCAACTCTACAGAAATAAAGAACTTACTGCTCAATGCCCTCTACACTGTCAGAGTGGCTGCGGTGAC
T
AGTCGTGGGATAGGAAACTGGAGCGATTCTAAGTCCATCACCACCATAAAAGGAAAAGTGATCCAAGCA
CCA
AATATCCACATTGACAGCTACGATGAAAATTCTCTGAGCTTTACCCTGACCATGGATGGTGACATCA
AG
GTCAATGGCTACGTGGTGAACCTTTTCTGGTCATTTGATGCCCACAAACAAGAAAAGAAAACCCTGAG
C
TTCCGCGGAGGGAGTGCACTGTCACACAGAGTTAGCAACCTGACAGCTCATACATCCTATGAGATTTCT
GCC
TGGGCCAAGACAGACTTGGGAGATAGCCCACTGGCCTTTGAGCACATCTTGACCAGAGGCAGCAGTC
CA
CCAGCTCCTAGTCTCAAAGCCAAGGCCATCAATCAGACTGCAGTGGAGTGCATCTGGACTGGCCCCAA
G
AATGTGGTGTATGGTATTTTCTATGCCACATCCTTCCTTGACCTCTACCGAAACCCTAAGAGCGTAACT
ACT
TCGCTCCACAATAAGACAGTCATCGTCAGCAAGGATGAGCAGTATCTGTTTCTGGTCCGGGTGTTGA
TC
CCTTACCAAGGGCCGTCTTCTGACTACGTTGTAGTGAAGATGATCCCAGACAGCAGGCTCCCGCCTCG
G
CATCTGCACGCGGTCCACATAGGCAAAACCTCAGCACTCATCAAATGGGAATCGCCCTATGACTCTCCT
GAC
CAGGACTTGTTCTACGCCATTGCAGTGAAAGATCTGATCAGGAAGACGGACAGAAGCTACAAAGTCA
GA
TCCCGCAACAGTACTGTGGAGTACAGCCTAAGCAAGCTGGAACCTGGAGGGAAATACCACATCATTGT
C
CAGCTGGGAAACATGAGCAAGGATTCCAGCATAAAAATCACCACAGTTTCGTTATCAGCACCTGATGCC
TTA
AAAATCATAACGGAAAACGACCACGTTCTCCTCTTTTGGAAAAGCCTAGCACTGAAGGAAAAGCAGT
TC
AATGAAACCAGGGGCTATGAGATCCACATGTCTGACAGCGCTGTGAATCTCACCGCTTACCTCGGGAA
T
ACTACGGACAATTTCTTTAAAGTGTCCAACCTGAAGATGGGTCATAACTACACTTTCACGGTCCAAGCG
CGG
TGTCTCTTTGGTAGCCAGATCTGTGGGGAGCCCGCCGTGCTGCTGTACGATGAACTGAGCTCAGGTG
CA
GATGCGGCAGTGATCCAGGCTGCCCGGTCTACTGATGTTGCAGCTGTGGTGGTTCCCATCCTGTTCCT
G
ATCCTGCTGAGCCTGGGTGTCGGCTTCGCCATCCTCTACACGAAGCACCGTCGCTTACAAAGCAGCTTC
AGC
GCTTTCGCCAACAGCCACTACAGCTCCAGGCTGGGCTCGGCCATCTTCTCCTCAGGGGATGACCTAG
GA
GAGGACGATGAAGATGCTCCCATGATTACTGGATTCTCAGACGATGTCCCCATGGTGATAGCGTGA


Translation (2215 aa):
MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQDRGFFVVQGDPRDLRLGTHGDAPGAS
P
AARKPLRTRRSAALQPQPIQVYGQ
VSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYD
Y
GKSFSKISEKLNFGVGNNSEAVISQFYHSPADNKR
YIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLL
L
HSKASNLLLGFDRSHPNKQ
LWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRS
T
DFFQSRENQEVILEEVRDFQLRDKYMFATKVV
HLPGSQQQSSVQLWVSFGRKPMRAAQFVTKHPINEYY
I
ADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLV
RYFANEPFADFHRVEGL
Q
GVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCE
LSQGCSLHLAQRLSQLLNLQLR
R
MPILSKESAPGLIIAT
GSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNE
L
KYSTNEGETWKTFVFSEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDY
K
LWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYE
CDFGFKMSEDLSLEVCV
P
DPEFSGKPYSPPVPCPVGSSYRRTR
GYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAMRKSIY
R
YDLASGATEQLPLSGLRAAVALDFDYERNCLYWSDLALDTIQ
RLCLNGSTGQEVIINSGLETVEALAFE
P
LSQLLYWVDAGFKKIE
VANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSYMDGS
A
AYRLVSEDVKWPNGISVDSQWIYWTDAYLDCIERITFSGQQRSVILDSLPHPYAIAVFK
NEIYWDDWSQ
L
SIFRASKHSRSQVEILASQLTGLMDMKVFYKGKNA
GSNACVPQPCSLLCLPKANNSKSCRCPEGVASSV
L
PSGDLMCDCPQGYQRKNNTCVKE
ENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDAD
T
QFRCQESGTCIPLSYKCDLEDDCGDNSDESHC
EMHQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEA
N
CT
AIYHTCEASNFQCHNGHCIPQRWACDGDADCQDGSDEDPVSCEKKCNGFHCPNGTCIPSSKHCDGLR
D
CPDGSDEQHC
EPFCTRFMDFVCKNRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGF
Q
CQNGVCISLIWKCDGMDDCGDYSDEANC
ENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDE
K
DCG
DSHVLPSPTPGPSTCLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTAASTPTQFGQ
C
DRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANC
PTHSTLTCTSREFKCEDGEACIVLSERCDGFLDC
S
DESDEKACS
DELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKT
S
TVLKVLKPDTTYQVKVQVHCLNKVHNTNDFVTLRTPEG
LPDAPRNLQLSLNSEEEGVILGHWAPPVHTH
G
LIREYI
VEYSRSGSKMWASQRAASNSTEIKNLLLNALYTVRVAAVTSRGIGNWSDSKSITTIKGKVIQA
P
NIHIDSYDENSLSFTLTMDGDIK
VNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHRVSNLTAHTSYEIS
A
WAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNV
VYGIFYATSFLDLYRNPKSVT
T
SLHNKTVIVSKDEQYLFL
VRVLIPYQGPSSDYVVVKMIPDSRLPPRHLHAVHIGKTSALIKWESPYDSP
D
QDL
FYAIAVKDLIRKTDRSYKVRSRNSTVEYSLSKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDA
L
KIITENDHVLLFWKSLALKEKQFNETR
GYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQA
R
CLFGSQICGEPAVLLYDELSS
GADAAVIQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSF
S
AFANSHYSSRLGSAIFSSGDDL
GEDDEDAPMITGFSDDVPMVIA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser