NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40284.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40284.1 Public Mus musculus 8 Defb2 16 104 75 CCDS HistoryNCBI Gene:13215Re-query CCDS DB by CCDS ID:40284.1Re-query CCDS DB by GeneID:13215

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 40284.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000006745 ENSMUSP00000006745 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000006745Link to Ensembl Protein Viewer:ENSMUSP00000006745Re-query CCDS DB by Nucleotide ID:ENSMUST00000006745Re-query CCDS DB by Protein ID:ENSMUSP00000006745
Original member Current member EBI,WTSI OTTMUST00000049141 OTTMUSP00000022725 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049141Link to Vega Protein Viewer:OTTMUSP00000022725Re-query CCDS DB by Nucleotide ID:OTTMUST00000049141Re-query CCDS DB by Protein ID:OTTMUSP00000022725
Original member Current member NCBI NM_010030.1 NP_034160.1 Accepted alive Link to Nucleotide Sequence:NM_010030.1Link to Protein Sequence:NP_034160.1Re-query CCDS DB by Nucleotide ID:NM_010030Re-query CCDS DB by Protein ID:NP_034160Link to BLink:NP_034160.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034160.1 71 P82020 71 100% 0 0

Chromosomal Locations for CCDS 40284.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

Chromosome Start Stop Links
8 21839959 21840019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 21843272 21843426 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (216 nt):
ATGAGGACTCTCTGCTCTCTGCTGCTGATATGCTGCCTCCTTTTCTCATATACCACTCCAGCTGTTGGAA
GT
TTAAAAAGTATTGGATACGAAGCAGAACTTGACCACTGCCACACCAATGGAGGGTACTGTGTCAGAGC
C
ATTTGTCCTCCTTCTGCCAGGCGTCCTGGGAGCTGTTTCCCAGAGAAGAACCCCTGTTGCAAGTACATG
AAA
TGA


Translation (71 aa):
MRTLCSLLLICCLLFSYTTPAVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM
K




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser