NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39952.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39952.1 Public Mus musculus 7 Ftl1 16 104 75 CCDS HistoryNCBI Gene:14325Re-query CCDS DB by CCDS ID:39952.1Re-query CCDS DB by GeneID:14325

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39952.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094434 ENSMUSP00000092002 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094434Link to Ensembl Protein Viewer:ENSMUSP00000092002Re-query CCDS DB by Nucleotide ID:ENSMUST00000094434Re-query CCDS DB by Protein ID:ENSMUSP00000092002
Original member Current member EBI,WTSI OTTMUST00000054058 OTTMUSP00000025746 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054058Link to Vega Protein Viewer:OTTMUSP00000025746Re-query CCDS DB by Nucleotide ID:OTTMUST00000054058Re-query CCDS DB by Protein ID:OTTMUSP00000025746
Original member Current member NCBI NM_010240.2 NP_034370.2 Accepted alive Link to Nucleotide Sequence:NM_010240.2Link to Protein Sequence:NP_034370.2Re-query CCDS DB by Nucleotide ID:NM_010240Re-query CCDS DB by Protein ID:NP_034370Link to BLink:NP_034370.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034370.2 183 P29391 183 99.4536% 0 1

Chromosomal Locations for CCDS 39952.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 45458107 45458283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45458535 45458660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45459084 45459230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45459530 45459631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (552 nt):
ATGACCTCTCAGATTCGTCAGAATTATTCCACCGAGGTGGAAGCTGCCGTGAACCGCCTGGTCAACTTGC
AC
CTGCGGGCCTCCTACACCTACCTCTCTCTGGGCTTCTTTTTTGATCGGGATGACGTGGCTCTGGAGGG
C
GTAGGCCACTTCTTCCGCGAATTGGCCGAGGAGAAGCGCGAGGGCGCGGAGCGTCTCCTCGAGTTTCAG
AAC
GATCGCGGGGGCCGTGCACTCTTCCAGGATGTGCAGAAGCCATCTCAAGATGAATGGGGTAAAACCC
AG
GAGGCCATGGAAGCTGCCTTGGCCATGGAGAAGAACCTGAATCAGGCCCTCTTGGATCTGCATGCCCT
G
GGTTCTGCCCGCGCGGACCCTCATCTCTGTGACTTCCTGGAAAGCCACTATCTGGATAAGGAGGTGAAA
CTC
ATCAAGAAGATGGGCAACCATCTGACCAACCTCCGCAGGGTGGCGGGGCCACAACCAGCGCAGACTG
GC
GCGCCCCAGGGGTCTCTGGGCGAGTATCTCTTTGAGCGCCTCACTCTCAAGCACGACTAG


Translation (183 aa):
MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQ
N
DRGGRALFQDVQ
KPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVK
L
IKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTLKHD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser