NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39856.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39856.1 Public Mus musculus 7 Dll3 16 104 75 CCDS HistoryNCBI Gene:13389Re-query CCDS DB by CCDS ID:39856.1Re-query CCDS DB by GeneID:13389

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39856.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000108315 ENSMUSP00000103951 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108315Link to Ensembl Protein Viewer:ENSMUSP00000103951Re-query CCDS DB by Nucleotide ID:ENSMUST00000108315Re-query CCDS DB by Protein ID:ENSMUSP00000103951
Original member Current member EBI,WTSI OTTMUST00000053925 OTTMUSP00000025674 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053925Link to Vega Protein Viewer:OTTMUSP00000025674Re-query CCDS DB by Nucleotide ID:OTTMUST00000053925Re-query CCDS DB by Protein ID:OTTMUSP00000025674
Original member Current member NCBI NM_007866.2 NP_031892.2 Accepted alive Link to Nucleotide Sequence:NM_007866.2Link to Protein Sequence:NP_031892.2Re-query CCDS DB by Nucleotide ID:NM_007866Re-query CCDS DB by Protein ID:NP_031892Link to BLink:NP_031892.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031892.2 585 O88516-2 585 100% 0 0

Chromosomal Locations for CCDS 39856.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 28293921 28293926 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28294041 28294125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28294344 28294923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28296288 28296510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28298519 28298736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28298893 28299135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28300167 28300224 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28301284 28301565 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 28301684 28301746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1758 nt):
ATGGTCTCTCTGCAGGTGTCTCCGCTTTCCCAGACGCTGATCCTGGCTTTTCTTCTTCCTCAGGCACTGC
CA
GCTGGTGTCTTCGAGCTACAAATTCATTCTTTCGGGCCAGGCCCAGGCCTCGGGACCCCACGCTCCCC
C
TGCAACGCCCGAGGCCCTTGCCGCCTCTTCTTCAGGGTCTGCCTGAAGCCCGGAGTCTCCCAGGAGGCC
ACC
GAGTCCCTGTGCGCCCTGGGCGCAGCACTGAGCACGAGCGTCCCGGTCTATACGGAGCACCCCGGAG
AG
TCAGCGGCTGCCCTGCCGCTGCCTGATGGCCTCGTACGTGTGCCCTTCCGCGATGCTTGGCCGGGCAC
C
TTCTCCCTCGTCATTGAAACCTGGAGAGAGCAGCTGGGAGAGCATGCTGGAGGGCCCGCCTGGAACCTG
CTA
GCACGTGTGGTCGGCCGTAGACGCCTGGCGGCTGGGGGCCCGTGGGCCCGCGATGTGCAGCGCACAG
GC
ACATGGGAGTTGCACTTCTCCTACCGCGCGCGGTGCGAGCCGCCCGCCGTCGGGGCCGCCTGCGCGCG
C
CTGTGCCGCTCACGCAGTGCCCCCTCGCGGTGTGGCCCGGGACTGCGACCCTGCACGCCATTCCCAGAC
GAG
TGCGAAGCCCCGTCTGTGTGTCGACCAGGCTGCAGCCCCGAGCACGGCTACTGTGAAGAGCCTGATG
AA
TGCCGTTGCCTGGAGGGCTGGACTGGACCCCTCTGCACGGTCCCTGTCTCCACCAGTAGCTGCCTGAA
C
TCCAGGGTTCCTGGTCCTGCCAGCACTGGATGCCTTTTACCTGGGCCTGGACCTTGTGATGGGAACCCA
TGT
GCCAATGGGGGCAGCTGTAGTGAAACCTCTGGCTCCTTTGAATGTGCCTGTCCCCGGGGATTCTACG
GG
CTTCGATGTGAGGTGAGCGGGGTCACGTGCGCAGATGGACCCTGCTTCAATGGCGGCTTGTGTGTTGG
C
GGTGAAGATCCTGACTCTGCCTATGTCTGTCATTGCCCACCTGGTTTCCAAGGCTCTAACTGTGAGAAG
AGG
GTGGACCGCTGTAGCCTGCAGCCATGTCAGAATGGCGGCCTCTGCCTGGACCTGGGCCACGCGTTGC
GC
TGCCGCTGTCGCGCGGGATTCGCCGGGCCGCGCTGCGAGCACGACCTGGACGACTGCGCCGGCCGCGC
C
TGTGCCAACGGCGGCACGTGCGTGGAGGGCGGCGGCTCGCGCCGCTGCTCCTGTGCGCTGGGCTTCGGC
GGG
CGCGACTGCCGAGAACGCGCCGACCCCTGCGCCTCCCGCCCCTGCGCGCATGGAGGCCGTTGCTACG
CC
CACTTCTCTGGCCTGGTCTGCGCCTGCGCGCCCGGCTACATGGGCGTGAGATGCGAGTTCGCTGTGCG
C
CCGGACGGCGCGGACGCGGTGCCCGCCGCCCCGCGGGGCCTGAGGCAGGCGGATCCACAGCGCTTTCTT
CTG
CCTCCCGCCTTGGGGCTGCTGGTGGCCGCCGGTTTGGCTGGCGCCGCACTCTTGGTCATCCACGTTC
GC
CGCCGAGGTCCTGGCCAGGATACCGGGACTCGCCTGCTTTCTGGGACCCGGGAGCCTTCGGTCCACAC
G
CTCCCGGATGCACTCAACAACCTGAGGTTACAAGACGGTGCTGGGGATGGCCCCAGTTCGTCGGCTGAC
TGG
AATCATCCTGAAGATGGAGACTCTAGATCCATTTATGTCATACCAGCCCCTTCCATTTATGCACGAG
AG
GCCTGA


Translation (585 aa):
MVSLQVSPLSQTLILAFLLPQALPAGVFELQIHSFGPGPGLGTPRSPCNARGPCRLFFRVCLKPGVSQEA
T
ESLCALGAALSTSVPVYTEHPGESAAALPLPDGLVRVPFRDAWP
GTFSLVIETWREQLGEHAGGPAWNL
L
ARVVGRRRLAAGGPWARDVQRTGTWELHFSYRARCEPPAVGAACARLCRSRSAPSRCGPGLRPCTPFPD
E
CEAP
SVCRPGCSPEHGYCEEPDECRCLEGWTGPLCTVPVSTSSCLNSRVPGPASTGCLLPGPGPCDGNP
C
ANGGSCS
ETSGSFECACPRGFYGLRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPGFQGSNCEK
R
VDRCSLQPCQN
GGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGSRRCSCALGFG
G
RDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGVRCEFAVRPDGADAVPAAPRGLRQADPQRFL
L
PPALGLLVAAGLAGAALLVIHVRRRGPGQDTGTRLLSGTREPSVHTLPDALNNLRLQDGAGDGP
SSSAD
W
NHPEDGDSRSIYVIPAPSIYARE
A



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser