NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39641.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39641.2 Public Mus musculus 6 Scnn1a 16 104 75 CCDS HistoryNCBI Gene:20276Re-query CCDS DB by CCDS ID:39641.2Re-query CCDS DB by GeneID:20276

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Public Note for CCDS 39641.2
The coding region has been updated to extend the N-terminus. The use of an alternative upstream start codon would result in a protein that is 1 aa longer.

Sequence IDs included in CCDS 39641.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000081440 ENSMUSP00000080164 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081440Link to Ensembl Protein Viewer:ENSMUSP00000080164Re-query CCDS DB by Nucleotide ID:ENSMUST00000081440Re-query CCDS DB by Protein ID:ENSMUSP00000080164
Original member Current member EBI,WTSI OTTMUST00000099477 OTTMUSP00000055834 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000099477Link to Vega Protein Viewer:OTTMUSP00000055834Re-query CCDS DB by Nucleotide ID:OTTMUST00000099477Re-query CCDS DB by Protein ID:OTTMUSP00000055834
Original member Current member NCBI NM_011324.2 NP_035454.2 Accepted alive Link to Nucleotide Sequence:NM_011324.2Link to Protein Sequence:NP_035454.2Re-query CCDS DB by Nucleotide ID:NM_011324Re-query CCDS DB by Protein ID:NP_035454Link to BLink:NP_035454.2

Chromosomal Locations for CCDS 39641.2

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 125321881 125322374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125330911 125331184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125332093 125332283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125337797 125337900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125338236 125338399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125338837 125338935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125339106 125339223 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125342602 125342680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125342788 125342845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125343021 125343076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125343222 125343297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125343699 125344088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2103 nt):
ATGATGCTGGACCACACCAGAGCCCCTGAGCTCAACCTTGACCTAGACCTTGACGTCTCCAACTCACCGA
AG
GGATCCATGAAGGGCAACAATTTCAAGGAGCAAGACCTTTGTCCTCCTCTGCCCATGCAAGGACTGGG
C
AAGGGGGACAAGCGTGAAGAACAGGCGCTGGGCCCGGAACCCTCAGAGCCCCGGCAGCCCACCGAGGAG
GAG
GAGGCACTGATCGAGTTCCACCGCTCCTACCGGGAGCTCTTCCAGTTCTTCTGCAACAATACCACCA
TC
CACGGTGCCATCCGCCTGGTGTGCTCCAAGCACAACCGCATGAAGACGGCCTTCTGGGCGGTGCTCTG
G
CTCTGCACCTTCGGCATGATGTACTGGCAGTTTGCTTTGCTGTTCGAGGAATACTTCAGCTACCCCGTG
AGT
CTCAACATCAACCTCAATTCGGACAAGCTGGTCTTCCCTGCCGTCACTGTGTGCACCCTTAATCCTT
AC
AGATACACTGAAATTAAAGAGGATCTGGAAGAGCTGGACCGCATCACGGAACAGACGCTTTTTGACCT
G
TACAAATACAACTCTTCCTACACTCGCCAGGCTGGGGGCCGCCGCCGCAGCACCCGCGACCTCCGGGGT
GCT
CTCCCACACCCCCTGCAGCGCCTGCGCACACCACCTCCGCCCAATCCCGCCCGCTCGGCGCGCAGCG
CG
TCCTCCAGTGTACGCGACAACAATCCCCAAGTGGACAGGAAGGACTGGAAAATCGGCTTCCAACTGTG
C
AACCAGAACAAATCAGACTGCTTCTACCAGACATACTCATCCGGGGTGGATGCCGTGAGAGAATGGTAC
CGC
TTCCATTACATCAACATTCTGTCCAGACTGCCCGACACCTCGCCTGCTCTAGAGGAAGAAGCCCTGG
GC
AGCTTCATCTTTACCTGTCGTTTCAACCAGGCCCCCTGCAATCAGGCGAATTATTCTCAGTTCCACCA
C
CCCATGTATGGGAACTGCTACACTTTCAACAACAAGAACAACTCCAATCTCTGGATGTCTTCCATGCCT
GGA
GTCAACAATGGTTTGTCCCTGACACTGCGCACAGAGCAGAATGACTTCATCCCCCTGCTGTCCACAG
TG
ACGGGGGCCAGGGTGATGGTGCACGGTCAGGATGAGCCTGCTTTTATGGATGATGGTGGCTTCAACGT
G
AGGCCTGGTGTGGAGACCTCCATCAGTATGAGAAAGGAAGCCCTGGACAGCCTCGGAGGCAACTACGGA
GAC
TGCACTGAGAATGGCAGTGATGTCCCTGTCAAGAACCTTTACCCCTCCAAGTACACACAGCAGGTGT
GC
ATTCACTCCTGCTTCCAGGAGAACATGATCAAGAAGTGTGGCTGTGCCTACATCTTCTACCCTAAGCC
C
AAGGGTGTAGAGTTCTGTGACTACCTAAAGCAGAGCTCCTGGGGCTACTGCTACTATAAACTGCAGGCT
GCC
TTCTCCTTGGATAGCCTGGGCTGCTTCTCCAAGTGCAGGAAGCCGTGCAGTGTGACCAACTACAAGC
TC
TCTGCTGGCTACTCAAGATGGCCGTCTGTGAAGTCCCAGGATTGGATCTTCGAGATGCTATCCTTGCA
G
AATAATTACACGATCAACAACAAAAGAAACGGAGTTGCTAAACTCAACATCTTCTTCAAAGAGCTGAAC
TAT
AAAACTAATTCGGAGTCTCCCTCTGTCACGATGGTCAGCCTCCTGTCCAACCTGGGCAGCCAGTGGA
GC
CTGTGGTTCGGCTCATCTGTGCTGTCCGTGGTGGAAATGGCGGAGCTCATCTTCGACCTCCTGGTCAT
C
ACACTCATCATGTTACTGCACAGGTTCCGGAGCCGGTACTGGTCTCCAGGACGAGGGGCCAGGGGTGCC
AGG
GAGGTGGCCTCTACCCCAGCTTCCTCCTTCCCTTCCCGTTTCTGTCCCCACCCTACATCCCCGCCAC
CT
TCTTTGCCCCAGCAGGGCACGACCCCTCCCCTGGCCCTGACAGCCCCTCCACCTGCCTATGCTACCCT
A
GGCCCCTCTGCCTCTCCACTGGACTCGGCTGTGCCTGGCTCTTCTGCCTGTGCTCCGGCCATGGCACTC
TGA


Translation (700 aa):
MMLDHTRAPELNLDLDLDVSNSPKGSMKGNNFKEQDLCPPLPMQGLGKGDKREEQALGPEPSEPRQPTEE
E
EALIEFHRSYRELFQFFCNNTTIHGAIRLVCSKHNRMKTAFWAVLWLCTFGMMYWQFALLFEEYFSYPV
S
LNINLNSDKLVFPAVTVCTLNPY
RYTEIKEDLEELDRITEQTLFDLYKYNSSYTRQAGGRRRSTRDLRG
A
LPHPLQRLRTPPPPNPARSARSASSSVRDNNPQVDRKDWKIGFQL
CNQNKSDCFYQTYSSGVDAVREWY
R
FHYINILSRLPDTSPALEEEALGSFIFTCRFNQAPCNQ
ANYSQFHHPMYGNCYTFNNKNNSNLWMSSMP
G
VNN
GLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYG
D
CTENGSDVPVKNLYPSKYTQQ
VCIHSCFQENMIKKCGCAYIFYPKPKGVEFCDYLKQSSWGYCYYKLQA
A
FSLDSLGCFSKCRKPC
SVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELN
Y
KTNSESPSVT
MVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITLIMLLHRFRSRYWSPGRGARGA
R
EVASTPASSFPSRFCPHPTSPPPSLPQQGTTPPLALTAPPPAYATLGPSASPLDSAVPGSSACAPAMAL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser