NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39606.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39606.1 Public Mus musculus 6 Cxcl12 16 104 75 CCDS HistoryNCBI Gene:20315Re-query CCDS DB by CCDS ID:39606.1Re-query CCDS DB by GeneID:20315See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39606.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112866 ENSMUSP00000108487 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112866Link to Ensembl Protein Viewer:ENSMUSP00000108487Re-query CCDS DB by Nucleotide ID:ENSMUST00000112866Re-query CCDS DB by Protein ID:ENSMUSP00000108487
Original member Current member EBI,WTSI OTTMUST00000054662 OTTMUSP00000026112 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054662Link to Vega Protein Viewer:OTTMUSP00000026112Re-query CCDS DB by Nucleotide ID:OTTMUST00000054662Re-query CCDS DB by Protein ID:OTTMUSP00000026112
Original member Current member NCBI NM_021704.3 NP_068350.1 Accepted alive Link to Nucleotide Sequence:NM_021704.3Link to Protein Sequence:NP_068350.1Re-query CCDS DB by Nucleotide ID:NM_021704Re-query CCDS DB by Protein ID:NP_068350Link to BLink:NP_068350.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068350.1 89 P40224-1 89 100% 0 0

Chromosomal Locations for CCDS 39606.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 117168656 117168716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 117171482 117171599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 117173492 117173582 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (270 nt):
ATGGACGCCAAGGTCGTCGCCGTGCTGGCCCTGGTGCTGGCCGCGCTCTGCATCAGTGACGGTAAACCAG
TC
AGCCTGAGCTACCGATGCCCCTGCCGGTTCTTCGAGAGCCACATCGCCAGAGCCAACGTCAAGCATCT
G
AAAATCCTCAACACTCCAAACTGTGCCCTTCAGATTGTTGCACGGCTGAAGAACAACAACAGACAAGTG
TGC
ATTGACCCGAAATTAAAGTGGATCCAAGAGTACCTGGAGAAAGCTTTAAACAAGTAA


Translation (89 aa):
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQV
C
IDPKLKWIQEYLEKALNK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser