NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38965.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38965.1 Public Mus musculus 4 Mfn2 16 104 75 CCDS HistoryNCBI Gene:170731Re-query CCDS DB by CCDS ID:38965.1Re-query CCDS DB by GeneID:170731

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 38965.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030884 ENSMUSP00000030884 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030884Link to Ensembl Protein Viewer:ENSMUSP00000030884Re-query CCDS DB by Nucleotide ID:ENSMUST00000030884Re-query CCDS DB by Protein ID:ENSMUSP00000030884
Original member Current member EBI,WTSI ENSMUST00000105715 ENSMUSP00000101340 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105715Link to Ensembl Protein Viewer:ENSMUSP00000101340Re-query CCDS DB by Nucleotide ID:ENSMUST00000105715Re-query CCDS DB by Protein ID:ENSMUSP00000101340
Original member Current member EBI,WTSI ENSMUST00000105716 ENSMUSP00000101341 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105716Link to Ensembl Protein Viewer:ENSMUSP00000101341Re-query CCDS DB by Nucleotide ID:ENSMUST00000105716Re-query CCDS DB by Protein ID:ENSMUSP00000101341
Original member Current member EBI,WTSI OTTMUST00000024883 OTTMUSP00000011416 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024883Link to Vega Protein Viewer:OTTMUSP00000011416Re-query CCDS DB by Nucleotide ID:OTTMUST00000024883Re-query CCDS DB by Protein ID:OTTMUSP00000011416
Original member Current member EBI,WTSI OTTMUST00000024884 OTTMUSP00000011417 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024884Link to Vega Protein Viewer:OTTMUSP00000011417Re-query CCDS DB by Nucleotide ID:OTTMUST00000024884Re-query CCDS DB by Protein ID:OTTMUSP00000011417
Original member Current member EBI,WTSI OTTMUST00000024886 OTTMUSP00000011419 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024886Link to Vega Protein Viewer:OTTMUSP00000011419Re-query CCDS DB by Nucleotide ID:OTTMUST00000024886Re-query CCDS DB by Protein ID:OTTMUSP00000011419
Original member Current member NCBI NM_001285920.1 NP_001272849.1 Accepted alive Link to Nucleotide Sequence:NM_001285920.1Link to Protein Sequence:NP_001272849.1Re-query CCDS DB by Nucleotide ID:NM_001285920Re-query CCDS DB by Protein ID:NP_001272849Link to BLink:NP_001272849.1
Original member Current member NCBI NM_001285921.1 NP_001272850.1 Accepted alive Link to Nucleotide Sequence:NM_001285921.1Link to Protein Sequence:NP_001272850.1Re-query CCDS DB by Nucleotide ID:NM_001285921Re-query CCDS DB by Protein ID:NP_001272850Link to BLink:NP_001272850.1
Original member Current member NCBI NM_001285922.1 NP_001272851.1 Accepted alive Link to Nucleotide Sequence:NM_001285922.1Link to Protein Sequence:NP_001272851.1Re-query CCDS DB by Nucleotide ID:NM_001285922Re-query CCDS DB by Protein ID:NP_001272851Link to BLink:NP_001272851.1
Original member Current member NCBI NM_001285923.1 NP_001272852.1 Accepted alive Link to Nucleotide Sequence:NM_001285923.1Link to Protein Sequence:NP_001272852.1Re-query CCDS DB by Nucleotide ID:NM_001285923Re-query CCDS DB by Protein ID:NP_001272852Link to BLink:NP_001272852.1
Original member Current member NCBI NM_133201.3 NP_573464.2 Accepted alive Link to Nucleotide Sequence:NM_133201.3Link to Protein Sequence:NP_573464.2Re-query CCDS DB by Nucleotide ID:NM_133201Re-query CCDS DB by Protein ID:NP_573464Link to BLink:NP_573464.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001272849.1 757 Q80U63-1 757 100% 0 0
NP_001272850.1 757 Q80U63-1 757 100% 0 0
NP_001272851.1 757 Q80U63-1 757 100% 0 0
NP_001272852.1 757 Q80U63-1 757 100% 0 0
NP_573464.2 757 Q80U63-1 757 100% 0 0

Chromosomal Locations for CCDS 38965.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 147875389 147875458 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147876951 147877085 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147878714 147878910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147879942 147880097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147882017 147882237 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147882881 147882983 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147883218 147883322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147883627 147883753 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147885453 147885574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147885681 147885748 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147886271 147886424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147887206 147887313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147887415 147887523 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147888620 147888744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147890114 147890276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147894563 147894698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 147898464 147898638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2274 nt):
ATGTCCCTGCTCTTTTCTCGATGCAACTCCATCGTCACCGTCAAGAAGGATAAGCGACACATGGCTGAAG
TG
AATGCTTCCCCTCTCAAGCACTTTGTCACTGCCAAGAAAAAGATCAATGGAATCTTTGAGCAGCTGGG
G
GCCTACATCCAAGAGAGCGCCAGCTTCCTTGAAGACACCCACAGGAACACAGAACTGGACCCGGTTACC
ACG
GAAGAGCAGGTCCTGGACGTCAAAGGGTACCTGTCCAAGGTCAGGGGTATCAGCGAAGTGCTGGCCA
GG
CGGCACATGAAGGTGGCTTTTTTTGGCCGGACGAGCAATGGGAAGAGCACCGTGATCAATGCCATGCT
C
TGGGACAAAGTTCTGCCATCTGGGATTGGTCATACCACCAATTGCTTCCTGCGGGTTGGGGGCACAGAT
GGC
CATGAGGCCTTCCTCCTCACAGAGGGCTCAGAAGAGAAGAAGAGTGTCAAGACTGTGAACCAACTGG
CC
CATGCCCTCCATCAGGACGAGCAGTTGCATGCAGGCAGCATGGTGAGTGTGATGTGGCCCAACTCCAA
G
TGTCCGCTCCTGAAGGATGACCTCGTGCTGATGGACAGCCCTGGGATCGATGTTACCACGGAGCTGGAC
AGC
TGGATTGATAAGTTTTGCCTGGATGCTGATGTGTTTGTGCTGGTGGCCAACTCAGAGTCCACGCTGA
TG
CAGACGGAGAAGCAGTTCTTCCACAAAGTGAGTGAACGTCTCTCCCGGCCCAACATCTTCATCCTGAA
C
AACCGCTGGGATGCGTCTGCCTCGGAGCCTGAGTACATGGAGGAGGTGCGGCGGCAGCACATGGAGCGC
TGC
ACCAGCTTTCTGGTGGATGAGCTGGGCGTGGTGGATCGAGCTCAGGCTGGGGACCGGATCTTCTTCG
TG
TCTGCCAAGGAGGTTCTCAGCGCCAGGGTCCAGAAAGCCCAGGGCATGCCAGAAGGAGGCGGCGCTCT
C
GCAGAAGGTTTTCAAGTGAGGATGTTTGAGTTTCAGAATTTCGAGAGGCAGTTTGAGGAGTGCATTTCC
CAG
TCTGCAGTAAAGACCAAATTTGAGCAGCACACAGTCCGGGCCAAGCAGATTGCAGAGGCCGTTCGTC
TC
ATCATGGATTCCCTGCACATCGCAGCTCAGGAGCAGCGGGTTTATTGCCTAGAAATGCGGGAAGAGCG
G
CAAGACCGGCTGAGGTTTATTGACAAGCAGCTGGAGCTCCTGGCTCAAGACTACAAGCTGCGAATTAAG
CAG
ATTACGGAGGAAGTGGAAAGGCAGGTGTCCACAGCCATGGCTGAAGAGATCAGGCGCCTCTCTGTGC
TA
GTTGACGAGTACCAGATGGACTTCCACCCATCCCCAGTTGTCCTCAAGGTTTATAAGAACGAGCTGCA
C
CGCCATATAGAGGAAGGTCTGGGCCGGAACCTGTCTGACCGCTGCTCCACTGCCATTGCCAGTTCACTG
CAG
ACTATGCAGCAGGACATGATAGACGGCTTGAAGCCCCTTCTTCCTGTATCTATGCGGAATCAGATAG
AC
ATGCTGGTCCCTCGACAGTGTTTCTCCCTCAGCTATGACCTGAATTGTGACAAGCTGTGTGCTGACTT
T
CAGGAGGACATCGAGTTCCACTTCTCCCTTGGATGGACTATGCTAGTGAACAGGTTCCTGGGCCCCAAG
AAT
AGCCGCCGGGCCTTGCTAGGCTACAGTGATCAGGTTCAGCGTCCTCTCCCTCTGACACCTGCCAACC
CC
AGCATGCCCCCCTTGCCACAGAGCTCCCTCACCCAGGAGGAGCTCATGGTCTCCATGGTTACTGGCCT
G
GCCTCTCTGACGTCTAGGACCTCCATGGGCATTCTTGTGGTCGGAGGAGTGGTGTGGAAGGCAGTGGGC
TGG
AGACTCATCGCCCTCTCCTTTGGACTGTATGGCCTCCTGTACGTCTATGAGCGACTGACCTGGACCA
CC
AAAGCCAAAGAGAGGGCCTTCAAGCGCCAGTTTGTGGAATACGCCAGTGAGAAGCTACAGCTCATCAT
C
AGTTACACCGGCTCTAACTGCAGCCACCAAGTCCAGCAGGAATTGTCTGGGACATTTGCTCATCTGTGC
CAG
CAAGTTGACATCACCCGAGATAATCTGGAGCAGGAAATTGCTGCCATGAACAAGAAAGTCGAGGCTC
TG
GATTCACTTCAGAGCAGAGCCAAACTGCTCAGGAATAAAGCTGGCTGGTTGGACAGCGAACTCAACAT
G
TTCACACACCAGTACCTGCAGCCCAGCAGATAG


Translation (757 aa):
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESASFLEDTHRNTELDPVT
T
EEQVLDVKGYLSKVRGISEVLARRHMKVAFFG
RTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTD
G
HEAFLLTEGSEEKKSVK
TVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELD
S
WIDKFCLDADVFVLVANSESTLMQT
EKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMER
C
TSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEG
GGALAEGFQVRMFEFQNFERQFEECIS
Q
SAVKTKFEQHTVRAKQIAEAVRLIMDSLHIAAQEQ
RVYCLEMREERQDRLRFIDKQLELLAQDYKLRIK
Q
ITEEVERQ
VSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNLSDRCSTAIASSL
Q
TMQQDMI
DGLKPLLPVSMRNQIDMLVPRQCFSLSYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPK
N
SRRALLGYSDQ
VQRPLPLTPANPSMPPLPQSSLTQEELMVSMVTGLASLTSRTSMGILVVGGVVWKAVG
W
RLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEYASEKLQLIISYTGSNCSHQVQ
QELSGTFAHLC
Q
QVDITRDNLEQEIAAMNKKVEALDSLQSRAKLL
RNKAGWLDSELNMFTHQYLQPSR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser