NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38483.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38483.1 Public Mus musculus 3 Lmna 16 104 75 CCDS HistoryNCBI Gene:16905Re-query CCDS DB by CCDS ID:38483.1Re-query CCDS DB by GeneID:16905

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 38483.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036252 ENSMUSP00000040265 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036252Link to Ensembl Protein Viewer:ENSMUSP00000040265Re-query CCDS DB by Nucleotide ID:ENSMUST00000036252Re-query CCDS DB by Protein ID:ENSMUSP00000040265
Original member Current member EBI,WTSI OTTMUST00000075094 OTTMUSP00000039299 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000075094Link to Vega Protein Viewer:OTTMUSP00000039299Re-query CCDS DB by Nucleotide ID:OTTMUST00000075094Re-query CCDS DB by Protein ID:OTTMUSP00000039299
Original member Current member NCBI NM_019390.3 NP_062263.1 Accepted alive Link to Nucleotide Sequence:NM_019390.3Link to Protein Sequence:NP_062263.1Re-query CCDS DB by Nucleotide ID:NM_019390Re-query CCDS DB by Protein ID:NP_062263Link to BLink:NP_062263.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062263.1 462 P48678-3 462 100% 0 0

Chromosomal Locations for CCDS 38483.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 88483297 88483413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88483827 88483946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88484047 88484154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88484615 88484837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88484927 88485147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88486204 88486329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88486460 88486630 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88486808 88486933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88488275 88488431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 88493237 88493256 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1389 nt):
ATGGGGAACGCGGAGGGCCGCAACACCAAGAAGGAGGGGGACTTGTTGGCTGCGCAGGCCCGGCTCAAGG
AC
CTCGAGGCTCTTCTCAACTCCAAGGAAGCTGCCCTGAGCACTGCTCTCAGTGAGAAGCGCACATTGGA
G
GGCGAGCTCCATGACCTGCGGGGGCAGGTAGCCAAGCTTGAGGCGGCCCTGGGAGAGGCTAAGAAGCAG
CTT
CAGGATGAGATGCTGAGGCGAGTGGATGCTGAGAACAGGCTACAGACGCTGAAGGAGGAGCTTGACT
TC
CAGAAGAACATTTACAGCGAGGAACTGCGTGAGACCAAGCGCCGGCATGAGACGCGGCTTGTGGAGAT
C
GATAACGGGAAGCAGCGAGAGTTTGAGAGCCGGCTGGCAGATGCCCTGCAGGAGCTGCGGGCTCAGCAT
GAG
GACCAGGTGGAACAGTATAAGAAGGAGCTAGAAAAGACATACTCCGCCAAGCTGGATAATGCCAGGC
AG
TCTGCTGAGAGGAACAGCAACCTCGTGGGGGCTGCCCATGAGGAACTGCAGCAGTCTCGAATCCGCAT
T
GACAGCCTCTCGGCCCAGCTCAGCCAGCTCCAAAAGCAGTTGGCAGCCAAGGAGGCAAAGCTGCGTGAC
CTG
GAGGACTCGCTGGCCCGTGAGCGCGATACCAGCCGGCGCCTGCTGGCTGAGAAAGAGCGAGAGATGG
CG
GAGATGCGGGCGAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTGCTGGACATCAAGCTGGCCCT
G
GACATGGAGATCCATGCCTATCGAAAGCTGCTGGAGGGCGAGGAGGAGAGGCTGCGCCTGTCCCCCAGC
CCT
ACCTCGCAGCGCAGCCGTGGCCGCGCCTCCTCCCACTCATCCCAGTCTCAGGGTGGAGGCAGCGTCA
CC
AAAAAGCGCAAGCTGGAGTCTTCCGAGAGCCGGAGCAGCTTCTCGCAGCATGCTCGCACTAGCGGGCG
T
GTGGCGGTAGAGGAAGTCGATGAAGAGGGAAAGTTCGTGCGGCTGCGCAACAAGTCCAACGAGGACCAG
TCC
ATGGGCAACTGGCAGATCAGGCGTCAGAATGGTGACGATCCTTTGATGACCTATCGCTTCCCACCGA
AG
TTCACCCTAAAGGCTGGGCAGGTGGTGACGATCTGGGCTTCAGGAGCTGGGGCCACCCATAGCCCCCC
T
ACTGACTTGGTGTGGAAGGCGCAGAACACCTGGGGCTGTGGGAGCAGCCTTCGCACCGCTCTCATCAAC
TCC
ACTGGAGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCACTGACCATGGTTGAGGACAATGAGGATG
AC
GACGAGGATGGAGAAGAGCTCCTCCATCACCACCGTGTGAGTGGCAGCCGCCGCTGA


Translation (462 aa):
MGNAEGRNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQ
L
QDEMLRRVDAENRLQTLKEELDFQKNIYSE
ELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQH
E
DQVEQYKKELEKTYSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRD
L
EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEE
RLRLSPS
P
TSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNE
DQ
S
MGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVT
IWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALIN
S
TGE
EVAMRKLVRSLTMVEDNEDDDEDGEELLHHHRVSGSRR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser