NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38355.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38355.1 Public Mus musculus 2 Gnas 19 105 81 CCDS HistoryNCBI Gene:14683Re-query CCDS DB by CCDS ID:38355.1Re-query CCDS DB by GeneID:14683See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 38355.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000087877 ENSMUSP00000085185 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000087877Link to Ensembl Protein Viewer:ENSMUSP00000085185Re-query CCDS DB by Nucleotide ID:ENSMUST00000087877Re-query CCDS DB by Protein ID:ENSMUSP00000085185
Original member Current member EBI,WTSI OTTMUST00000039464 OTTMUSP00000017949 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039464Link to Vega Protein Viewer:OTTMUSP00000017949Re-query CCDS DB by Nucleotide ID:OTTMUST00000039464Re-query CCDS DB by Protein ID:OTTMUSP00000017949
Original member NCBI NM_201617.1 NP_963911.1 Updated not alive Link to Nucleotide Sequence:NM_201617.1Link to Protein Sequence:NP_963911.1Re-query CCDS DB by Nucleotide ID:NM_201617Re-query CCDS DB by Protein ID:NP_963911
Current member NCBI NM_201617.2 NP_963911.1 Accepted alive Link to Nucleotide Sequence:NM_201617.2Link to Protein Sequence:NP_963911.1Re-query CCDS DB by Nucleotide ID:NM_201617Re-query CCDS DB by Protein ID:NP_963911Link to BLink:NP_963911.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_963911.1 876 Q6R0H7-2 876 100% 0 0

Chromosomal Locations for CCDS 38355.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 174297862 174300217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 174300431 174300705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2631 nt):
ATGGGCATGTTCAACTGCCTCCACGGCAATAATATGTCAGGACAACACGATATCCCCCCTGAAGTCGGGG
AG
CAGCCCGAGCAAGAACCTTTGGAAGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGGCTGGCCCAGCCGA
A
GAAATGGCGACCGAACCGGACTCCGAACCGTCTAACAATGAGCCCGTCCCCGACGAGACTGGCAGTGAG
ATC
AGTGGACCCCCAGAAGACTCCAAATCTGACATCCAAAGCCCCTGCCAGGCCTTCGAGGAAGTCCGAG
TG
GGTGGAGACTACAGCCCACCTCCGGAGGAAGCCATGCCATTCGAGACACAACAGCCCAGCCTGGGAGA
T
TTCTGGCCCACCCTGGAGCAGCCAGGACCATCTGGGACCCCATCAGGCCTCCAAGCCTTCAACCCAGCG
ATT
TTGGAGCCCGGGACCCCCACTGGCGCGAGCCCAGGCCTGGGAGCCTATACCCCCCCACCAGAAGAAG
CT
ATGCCATTTGAGTTCAACGAGCCTGCCCAGGGAGACCATAGCCAGCCTCCCTTGCAAGTCCCAGACCT
T
GCGCCAGGAGGTCCGGAAGCATTGGTCCCCAGAGCTCTTCCCGCGGAGCCCGGGAACATCAGATTTGAA
AAC
GCTGGCTTCCGAGAAGACTACAGCCCTCCCCCTGAAGAATCTGTGCCATTTCAGGTCGGTGGAGAAG
AA
TTCGGGGGCGATAGCCCACCCCCAGGACTCCCGCGAGTCATCCCACAAATCGGCATTGGCGGCGAGTT
C
CCGACAGTCGCGGTCCCGAGTGCGCTCTGCCTCGCTCCCGCCGAGAACGCGCCTCCCCTCTGGGTCCGA
GGC
GCCATTGACAGACCATTCCGCGAGGCTGTCAGATCTCCTCCTAACTTCGCATGCGACAGCCCCCCGA
TG
GAGATCACCAGACCCCTGCTTGAGATTGGCAGAGCCTCCATTGGGGTCGACGACGACACCGCTGTCAA
T
ATGGACAGCCCCCCAATCGCAAGTGATGGCCCGCCCATCGAAGTCTCGGGAGCCCCAGATAAGAGCGAG
TGC
GCAGAGAGACCCCCAGTTGAGCGAGAAGCAGCCGAGATGGAAGGAAGCCCTACCACCGCCACTGCGG
TG
GAAGGAAAAGTCCCCTCTCCGGAGAGAGGGGACGGATCTTCCACCCAGCCTGAAGCAATGGATGCCAA
G
CCAGCCCCTGCTGCCCAAGCCGTCTCTACCGGATCTGATGCTGGAGCTCCTACGGATTCCGCGATGCTC
ACA
GATAGCCAGAGCGATGCCGGAGAAGACGGGACAGCCCCAGGAACGCCTTCAGATCTCCAGTCGGATC
CT
GAAGAACTCGAAGAAGCCCCAGCTGTCCGCGCCGATCCTGACGGAGGGGCAGCCCCAGTCGCCCCAGC
C
ACTCCTGCCGAGTCCGAGTCTGAAGGCAGCAGAGATCCAGCCGCCGAGCCAGCCTCCGAGGCAGTCCCT
GCC
ACCACGGCCGAGTCTGCCTCCGGGGCAGCCCCTGTCACCCAGGTGGAGCCCGCAGCCGCGGCAGTCT
CT
GCCACCCTGGCGGAGCCTGCCGCCCGGGCAGCCCCTATCACCCCCAAGGAGCCCACTACCCGGGCAGT
C
CCCTCTGCTAGAGCCCATCCGGCCGCTGGAGCAGTCCCTGGCGCCCCAGCAATGTCAGCCTCTGCTAGG
GCA
GCTGCCGCTAGGGCAGCCTATGCAGGTCCACTGGTCTGGGGAGCCAGGTCACTCTCAGCTACTCCCG
CC
GCTCGGGCATCCCTTCCTGCCCGCGCAGCAGCTGCCGCCCGGGCAGCCTCTGCTGCCCGCGCAGTCGC
T
GCTGGCCGGTCAGCCTCTGCCGCCCCCAGCAGGGCCCATCTTAGACCCCCCAGCCCCGAGATCCAGGTT
GCT
GACCCGCCTACTCCGCGGCCTCCTCCGCGGCCGACTGCCTGGCCTGACAAGTACGAGCGGGGCCGAA
GC
TGCTGCAGGTACGAGGCATCGTCTGGCATCTGCGAGATCGAGTCCTCCAGTGATGAGTCGGAAGAAGG
G
GCCACCGGCTGCTTCCAGTGGCTTCTGCGGCGAAACCGCCGCCCTGGCCTGCCCCGGAGCCACACGGTC
GGG
AGCAACCCAGTCCGCAACTTCTTCACCCGAGCCTTCGGAAGCTGCTTCGGTCTATCCGAGTGTACCC
GA
TCACGATCCCTCAGCCCCGGGAAGGCCAAGGATCCTATGGAGGAGAGGCGCAAACAGATGCGCAAAGA
A
GCCATTGAGATGCGAGAGCAGAAGCGCGCAGATAAGAAACGCAGCAAGCTCATCGACAAGCAACTGGAG
GAG
GAGAAGATGGACTACATGTGTACACACCGCCTGCTGCTTCTAGGGAGAAAAGTGGTGCCGAGCGACA
CT
GAGGGTCGTTACCGGCCGGAGGCCAGCGCCAGCGCCAGCGATCGTAGGCTGGACAGGCGGGGGCGTGA
G
GTGAGCCCAGAACTGCTGGGGTGGGCCCTTCGGGGCTCCCCCGGCTCGATTGTTCGTGACCGCGGTGGG
CTA
GGGCCATCCGGGTGCGCGCCCCCGCCTCGCCTGGCACGGCTGCTTCGACTCAGACAGCTTGTTGTTG
GT
GTGTGTTGGTGTCCATTTTCTGTGTTCGCCTGTGCATGA


Translation (876 aa):
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPGAGAGPAEEMATEPDSEPSNNEPVPDETGSE
I
SGPPEDSKSDIQSPCQAFEEVRVGGDYSPPPEEAMPFETQQPSLGDFWPTLEQPGPSGTPSGLQAFNPA
I
LEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGDHSQPPLQVPDLAPGGPEALVPRALPAEPGNIRFE
N
AGFREDYSPPPEESVPFQVGGEEFGGDSPPPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVR
G
AIDRPFREAVRSPPNFACDSPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIASDGPPIEVSGAPDKSE
C
AERPPVEREAAEMEGSPTTATAVEGKVPSPERGDGSSTQPEAMDAKPAPAAQAVSTGSDAGAPTDSAML
T
DSQSDAGEDGTAPGTPSDLQSDPEELEEAPAVRADPDGGAAPVAPATPAESESEGSRDPAAEPASEAVP
A
TTAESASGAAPVTQVEPAAAAVSATLAEPAARAAPITPKEPTTRAVPSARAHPAAGAVPGAPAMSASAR
A
AAARAAYAGPLVWGARSLSATPAARASLPARAAAAARAASAARAVAAGRSASAAPSRAHLRPPSPEIQV
A
DPPTPRPPPRPTAWPDKYERGRSCCRYEASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTV
G
SNPVRNFFTRAFGSCFGLSECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLE
E
EKMDYMCTHRLLLL
GRKVVPSDTEGRYRPEASASASDRRLDRRGREVSPELLGWALRGSPGSIVRDRGG
L
GPSGCAPPPRLARLLRLRQLVVGVCWCPFSVFACA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser