NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38212.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38212.1 Public Mus musculus 2 Cdan1 16 104 75 CCDS HistoryNCBI Gene:68968Re-query CCDS DB by CCDS ID:38212.1Re-query CCDS DB by GeneID:68968See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 38212.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110701 ENSMUSP00000106329 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110701Link to Ensembl Protein Viewer:ENSMUSP00000106329Re-query CCDS DB by Nucleotide ID:ENSMUST00000110701Re-query CCDS DB by Protein ID:ENSMUSP00000106329
Original member Current member NCBI NM_026891.2 NP_081167.2 Accepted alive Link to Nucleotide Sequence:NM_026891.2Link to Protein Sequence:NP_081167.2Re-query CCDS DB by Nucleotide ID:NM_026891Re-query CCDS DB by Protein ID:NP_081167Link to BLink:NP_081167.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081167.2 1239 Q8CC12-1 1239 100% 0 0

Chromosomal Locations for CCDS 38212.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 120718802 120718927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120719141 120719248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120720424 120720605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120720734 120720797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120720882 120721010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120722610 120722758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120722939 120723017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120723192 120723255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120723748 120723906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120724133 120724236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120724333 120724466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120724672 120724726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120724892 120724981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120725176 120725263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120725595 120725761 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120725921 120726067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120726177 120726297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120726590 120726795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120727297 120727372 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120727858 120727947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120728334 120728443 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120728611 120728731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120729531 120729609 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120729689 120729802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120729930 120730099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120730299 120730505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120730702 120731192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120731412 120731501 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3720 nt):
ATGGCGGCCGTTTTAGAGTCGCTGCTGCGCGAAGAGGTGCCGGTCGCAGCCGCCGTGCGGTGGATCGCGC
GC
AGCACCCCGAGTTCGGAGGATAGCTCCGAGGTGGCCGCTCTGAGCGCACTTCGGCCTCTGCGGAAGGA
A
TTCGTGCCGTTCCTGCTGAACTTCCTGAGGGAGCAGAGCAGCCGGGTCCTCCCGCAGGGCCCCTCAACC
CCC
GCCAAGACCCCAGTCGCCTCGGCAGCCTTGCCAGCGAGGCAGGGGGCCCCGGCACGGGGTGGCCGTG
GG
GCGCGCAGCCAGCTTTTCCCTGCAGCCGAGCCCCTCAGCGCCGCCGCCGAGGCACCTCTGGCCCGCCG
T
GCGGGCCGCAGGCGGGGTCCGGGACCGGGGCCGTCCCGCGAACGAGGCGGTCGGGGCTCCGGGGCCGCG
GAG
GAGGGGGCGAGTGGCGAGAGCCCGCCTTGGGCCGGAGGCCGGAAGCCTAAGGGCTCAGGCAGCCCTG
GC
AGCCCCAGACTGTCGCTCTCTGATCCGCCAAACCTCAGCAACTTGGAGGAGTTCCCTCCCGTAGGCAC
C
GTTCCTCCGGGCTCTGCAGGCAGAACGAAGCCTTCTCGAAGGATCAACCCAACTCCGGTGAGCGAAGAG
CGG
TCACTGTCCAAGCCCAAGACCTGCTTCACCTCACCCCCAATCAGCTGTGTCCCCAGTTCCCAACCCT
CA
ACCCTGGACACTAGCCCTTGGGGCCTTGGCCTTCCCCCAGGGTGCAGAAGTCTGCAAGAGGAGCGGGA
G
ATGCTCAGGAAGGCGCGCACCAAGCAACTCCAGCAGTCACCTACCCCAGCCTCTCCCATCCCAGAATCG
GGG
TCTCCGGTTCCCAGCAGGACAGGAAACCTCACCGCAGAGCCTGCCGACCCGGCCAGAGTGTCTTCTC
GA
CAGCGCCTGGAGCTGGTAGCCCTTATCTACTCCTCCTGCATTGCTGAGAACCTAGTACCAAACCTTTT
C
TTGGAGCTTTTCTTCGTCCTTCAGCTCCTTACTGCTCGGAGAATGGTGGCCACCAAGGACAGTGACCTG
GAA
TCAAGTCAGGGTGCCCTAGATTCCCTGGACACTCCCCTGTTTCGTAGCATCCATGATTGCGTCTTCT
TT
GCAGTGCAAGTTTTGGAGCATCAGTTTCAGGTTCTCTCCTACCTGGATAAAGGGACCTTAAAGCTGCT
G
GCTGAGAATGAGCGGCTGCTGTGCTTCTCACCTGCTCTGCAGGGCCGCCTTCGGGCTGCTTATGAAGGC
AGT
GTTGCCAAGGTCTCCCTCGTGATACCACCCTCTGCTCAGGCTGTCTCCTTCCAGCCAGAAACTGACA
AT
CGTGCCAACTTCTCCAGTGATCGAGCCTTTCATACTTTTAAAAAACAGAGGGATGTGTTCTATGAGGT
A
CTTCGAGAGTGGGAAGATCATCACGAGGAACCCAGCTGGGATTTTGAGAAGGGCTTGGGTAGCAGGATC
AG
A
GCCATGATGGGTCAACTTTCAGCAGCCTGCAGCCACAGCCACTTTGTCCGCCTTTTCCAAAAACAGC
TT
CTCCAGATGTGTCAGAGCCCTGGCGGTGCTGGGGGATCTGTTCTGGGTGAAGCTCCAGATGTATTGAA
T
ATGCTAGGAGCTGACAAACTAGGACGGTTGCGGCAGCTCCAAGAACGGCTGATAGCCCCTCAGAGCAGT
GGA
GGGCCCTGCCCACCCCCCACATTCCCAGGCTGTCAAGGCTTCTTCAGGGATTTCATCATGAGTGCCA
GC
AGCTTCCATTTTAATCAGCACCTCATGGATAGTTTAAGTTTAAAGATTCGGGAGCTCAATGGCCTTCG
C
CTGCCTCAGCACGAGCCTGGTGATGAAGATGGGGAGTCAGACATGGACTGGCAGGGTGAACGGAGGCAA
TTT
GCTGTAGTGCTTCTTAGTCTTAGACTTTTGGCTAAATTTCTGGGCTTTGTGGCTTTCCTGCCATACC
GG
GGACATGAACCACCCCCGACCCGTGAGCTTCAGGACTCTATTCTGGCCCTCAGGAGCCAGGTCCCTCC
T
GTTCTGGATATACGGGCTTTGCTGCAGCAGGGATTGTGGGCCCGTCGGGCAGTGCTCACTGTGCCCTGG
CTG
GTAGAATTCCTCTCTTTTGCTGACCACATTGTCCCCTTGCTGGACTATTACCGGAGTGTCTTTACTC
TC
CTGCTGCGCTTACATCGGAGTTTGGTCTTATCAAAGGAGAATGAAGGAGAGATGTGCTTCCTGAATAA
G
CTGCTGCTGCTTGCTGTCCTGGGCTGGCTTTTCCAGATACCTACAGTTCCTGAGGACTTATTCTTTCTA
GAA
GATGGTCAGGTAGATGCCTTTGAGGTGACTACAACTGCTTCAGAGCATGGTTTGGACAGTGTACCTG
TT
GTGGACCAGCAGCTGTTATATACCTGTTGCCCCTACATTGGAGAGCTCCGGAAACTGCTTGCTTCCTG
G
GTTTCAGGAAGCAGTGGGCGGAGTGGAGGCTTTGTGAGGAAAATCACTCCCACTACCACCAGCAGCCTG
GGA
GCCCTGCCTCTCCAGACCAGCCAGGGGCTGCAGGCTCAACTTGCTGAGGCCTTTTTCCACAACCAGC
CA
CCCTCCCTGCGCAGGACTGTAGAATTTGTGGCAGAAAGAATTGGATCAAACTGTGTCAAACACATCAA
G
GCGACACTGGTAGCAGATTTGGTGCATCAAGCAGAGTCACTTCTTCAGGAGCAGCTGGTGGCACGGGGA
CAG
GAAGGGGGAGATCCAGCACAGCTTTTGGAATCCTTGTGTTCTCAACTCTGCCCCCATGGGGCCCAAG
CA
TTGACCCAGGGGCGGGAGTTCTGCCAAAGGAAGAGCCCCACCGCTGTGCGAGCACTGTTACCAGAGGA
G
ACCCCAGCTGCTGTTCTAAGCAGTGCAGAGAACATTGCTGTGGGGCTTGCGACAGAGAAAGCCTGCTCT
TGG
TTGTCAGCCAACATCACAGCGCTGATTAGAAGGGAAGTGAAAGCAGCCGTGAGTCGCATGCTACGAG
CC
CAGGGTCCTGAGCCAACTGCCCGGGTGGAGCGGAGGGGCTGCTCCCGAGCCTGTGAGCACCATGCTCC
C
CTCCCCTCCCACCTCATCTCCGAGATAAAATTTCATCACTGCTCTCTACAGGATGTGCTCTCCCTGGCG
GCC
GGGCCTCGGGACCCTGAGGAGGGAGTTTCCCCAGAGCATCTGGAACAGCTTCTAAACCAGATGGGCC
AG
TCACTGCGATGCCGCCAGTTCCTGTGCCCAACTGCTGAGCAGCATCTGGCCAAGTGCTCTGTAGAGTT
G
GCTTCCCTTCTAGTTGCAGACCAGATCCCCATCTTAGGGCCCCCAACACAGCACAGGCTGGAGCGAGGA
CAC
GCTCGGAGGCTTCTACATATGCTGCTTTCCTTGTGGAAGGATGACTTCCAGGGGCCAGTTCCATTAC
AG
CTTCTACTTAGCCCAAGAAATGTAGGGCTTCTGGCAGATACTAGGCCAAGAGAGTGGGATCTGCTGTT
G
TTCTTACTCCGGGAGCTGGTAGAAAAGGATCTCATGGGACATCTGGAGATAGAAGCCTGCTTAGGCCGC
CTT
AATGAGGCCCAGTGGCCAGGGGACTTCTCAGAAGAATTGTCAACACTGTTTCGCTTGTTCCTAGCTG
AG
CCCCATCTGCTAGAACCCCAGCTAAGAGCTTGTGAACTTATGCAACCAAACCGAGGGACAGTACTGGC
C
CAAAGCTAG


Translation (1239 aa):
MAAVLESLLREEVPVAAAVRWIARSTPSSEDSSEVAALSALRPLRKEFVPFLLNFLREQSSRVLPQGPST
P
AKTPVASAALPARQGAPARGGRGARSQLFPAAEPLSAAAEAPLARRAGRRRGPGPGPSRERGGRGSGAA
E
EGASGESPPWAGGRKPKGSGSPGSPRLSLSDPPNLSNLEEFPPVGTVPPGSA
GRTKPSRRINPTPVSEE
R
SLSKPKTCFTSPPISCVPSSQPSTLDTSPWGLGLPPGCRSLQEEREMLRKA
RTKQLQQSPTPASPIPES
G
SPVPSRTGNLTAEPADPARVSSRQRLELVALIYSSCIA
ENLVPNLFLELFFVLQLLTARRMVATKDSDL
E
SSQGAL
DSLDTPLFRSIHDCVFFAVQVLEHQFQVLSYLDKGTLKLLAENERLLCFSPALQGRLRAAYEG
S
VAK
VSLVIPPSAQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPSWDFEKGLGSRI
R
AMMGQLSAACSHSHFVRLFQKQLLQMCQSPGGAGGSVLGEAPDVLNMLGADKLGRLRQLQERLIAPQSS
G
GPCPPPTFPGCQGFFRDFIMSAS
SFHFNQHLMDSLSLKIRELNGLRLPQHEPGDEDGESDMDWQGERRQ
F
AVVLLSLRLLAKFLGFVAFLPYRGHEPPPTRELQDSILALRSQ
VPPVLDIRALLQQGLWARRAVLTVPW
L
VEFLSFADHIVPLLDYYRSVFTLLLRLH
RSLVLSKENEGEMCFLNKLLLLAVLGWLFQIPTVPEDLFFL
E
DGQVDAFEVTTTASEHGL
DSVPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFVRKITPTTTSSL
G
ALPLQTSQGLQ
AQLAEAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVHQAESLLQEQLVARG
Q
EGGDPAQLLESLCSQLCPHGAQALTQGR
EFCQRKSPTAVRALLPEETPAAVLSSAENIAVGLATEKACS
W
LSANIT
ALIRREVKAAVSRMLRAQGPEPTARVERRGCSRACEHHAPLPSHLISEIKFHHCSLQDVLSLA
A
GPRDPEEGVSPEHLEQLLNQMGQSLRCRQ
FLCPTAEQHLAKCSVELASLLVADQIPILGPPTQHRLERG
H
ARRLLHMLLSLWKDDFQGPVPLQLLLSPRNVGLLADTRPRE
WDLLLFLLRELVEKDLMGHLEIEACLGR
L
NEAQWPG
DFSEELSTLFRLFLAEPHLLEPQLRACELMQPNRGTVLAQS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser