NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38131.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38131.1 Public Mus musculus 2 Scn1a 19 105 81 CCDS HistoryNCBI Gene:20265Re-query CCDS DB by CCDS ID:38131.1Re-query CCDS DB by GeneID:20265See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47


Attributes
Inferred exon combination

Sequence IDs included in CCDS 38131.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000077489 ENSMUSP00000076697 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000077489Link to Ensembl Protein Viewer:ENSMUSP00000076697Re-query CCDS DB by Nucleotide ID:ENSMUST00000077489Re-query CCDS DB by Protein ID:ENSMUSP00000076697
Original member Current member EBI,WTSI OTTMUST00000031619 OTTMUSP00000014086 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000031619Link to Vega Protein Viewer:OTTMUSP00000014086Re-query CCDS DB by Nucleotide ID:OTTMUST00000031619Re-query CCDS DB by Protein ID:OTTMUSP00000014086
Original member Current member NCBI NM_018733.2 NP_061203.2 Accepted alive Link to Nucleotide Sequence:NM_018733.2Link to Protein Sequence:NP_061203.2Re-query CCDS DB by Nucleotide ID:NM_018733Re-query CCDS DB by Protein ID:NP_061203Link to BLink:NP_061203.2

Chromosomal Locations for CCDS 38131.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 66272885 66274062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66277562 66277832 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66280696 66280800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66285911 66286048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66287723 66287776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66288874 66289155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66296753 66296875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66299624 66299797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66302366 66302520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66303592 66303712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66317804 66318286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66319386 66319742 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66320868 66321041 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66322254 66322492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66323312 66323444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66324604 66324951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66325902 66326186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66327651 66327857 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66328405 66328546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66329031 66329094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66331239 66331508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66332207 66332298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66334208 66334336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66335440 66335529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66337878 66337996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 66350914 66351177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5997 nt):
ATGGAGCAAACAGTGCTTGTACCACCAGGACCTGACAGCTTCAACTTCTTCACCAGAGAATCCCTTGCAG
CT
ATTGAAAGGCGCATTGCAGAAGAGAAGGCTAAGAATCCCAAGCCAGACAAAAAAGATGATGATGAAAA
T
GGCCCAAAGCCAAACAGTGACTTGGAAGCTGGGAAGAACCTTCCATTTATCTATGGAGACATTCCTCCA
GAG
ATGGTGTCGGAGCCTCTGGAGGACCTGGACCCCTACTATATCAATAAGAAGACTTTTATAGTATTGA
AT
AAAGGGAAGGCCATCTTCCGGTTCAGTGCCACCTCCGCCCTGTACATTTTAACACCCTTCAATCCTCT
T
AGGAAAATAGCTATTAAGATTTTGGTACACTCATTATTCAGCATGTTAATCATGTGCACTATTTTGACA
AAC
TGTGTATTTATGACAATGAGTAACCCTCCCGACTGGACAAAGAATGTGGAGTACACCTTCACAGGAA
TA
TATACTTTTGAATCACTAATAAAAATTATTGCAAGGGGCTTCTGTTTAGAAGATTTTACTTTCCTTCG
C
GACCCATGGAACTGGCTGGACTTCACTGTCATTACATTCGCATATGTGACGGAGTTTGTGGACCTGGGC
AAT
GTCTCAGCATTGAGAACATTCAGAGTTCTTCGAGCATTGAAAACTATTTCAGTCATTCCAGGCCTGA
AG
ACCATCGTGGGGGCCCTGATCCAGTCGGTGAAGAAGCTGTCTGACGTCATGATACTCACTGTGTTCTG
T
CTCAGTGTGTTCGCACTCATCGGGTTGCAGCTCTTCATGGGCAACCTGAGGAATAAATGTGTACAGTGG
CCT
CCCACCAACGCTTCCCTTGAGGAACATAGCATAGAGAAGAATATAACTATGGATTACAATGGCACAC
TT
GTAAATGAAACCGTGTTCGAGTTTGACTGGAAATCATACATTCAAGACTCAAGATATCATTATTTCCT
G
GAGGGTGTTTTAGATGCACTGCTGTGTGGAAATAGCTCTGATGCAGGCCAATGTCCAGAAGGATATATG
TGT
GTAAAAGCTGGTAGAAACCCTAATTATGGTTACACAAGCTTTGATACCTTCAGTTGGGCATTTTTGT
CC
CTGTTTCGACTGATGACTCAGGACTTCTGGGAAAATCTATACCAACTGACATTGCGTGCTGCTGGCAA
A
ACCTACATGATATTTTTTGTGCTGGTCATTTTCTTGGGCTCATTCTACCTGATAAACTTGATCCTGGCT
GTG
GTGGCCATGGCCTATGAGGAGCAGAATCAGGCCACACTGGAGGAGGCTGAACAGAAAGAGGCAGAAT
TT
CAGCAGATGTTGGAGCAACTTAAGAAGCAGCAAGAGGCTGCACAGCAGGCAGCGGCTACAACAGCCTC
A
GAACATTCCAGGGAGCCCAGTGCAGCAGGCAGGCTCTCAGATAGCTCTTCAGAAGCCTCTAAGTTGAGT
TCG
AAGAGTGCTAAAGAAAGACGAAATCGGAGGAAAAAAAGGAAACAGAAAGAGCAGTCTGGAGGAGAAG
AG
AAAGATGATGATGAATTCCACAAGTCTGAGTCTGAAGACAGCATCAGGAGGAAGGGGTTTCGCTTCTC
C
ATAGAAGGGAATAGACTGACATATGAAAAGAGGTACTCTTCCCCGCATCAGTCTCTGTTAAGCATTCGT
GGT
TCCCTGTTCTCCCCAAGACGCAATAGCAGAACAAGTCTTTTCAGCTTTAGAGGGCGAGCCAAGGATG
TG
GGGTCTGAGAATGACTTTGCTGATGATGAACACAGCACCTTTGAGGATAATGAGAGCCGTAGAGACTC
A
CTGTTCGTTCCCCGAAGACACGGAGAGCGACGCAACAGTAACCTGAGCCAGACCAGCAGGTCCTCCCGA
ATG
CTGGCGGTGTTTCCAGCCAATGGGAAGATGCACAGCACGGTGGATTGCAATGGTGTGGTTTCCTTGG
TT
GGTGGACCCTCAGTTCCCACATCGCCAGTTGGACAGCTTCTGCCAGAGGGAACAACCACTGAAACTGA
G
ATGAGAAAGAGGAGGTCGAGCTCTTTCCATGTTTCCATGGACTTTCTAGAAGATCCTTCCCAGAGGCAA
AGG
GCAATGAGCATAGCCAGCATCTTAACAAATACAGTAGAAGAACTAGAAGAATCCAGGCAGAAATGTC
CA
CCCTGTTGGTATAAATTTTCCAACATATTCTTAATTTGGGACTGTTCTCCATATTGGCTGAAAGTTAA
A
CATATTGTCAACCTGGTGGTGATGGACCCATTTGTTGATCTGGCCATTACCATCTGCATTGTGTTAAAT
ACG
CTCTTCATGGCTATGGAGCACTACCCCATGACTGAACATTTCAACCATGTTCTTACAGTGGGAAACT
TG
GTCTTCACTGGGATTTTCACAGCAGAAATGTTCCTGAAAATCATCGCAATGGATCCTTACTATTACTT
C
CAAGAAGGCTGGAATATCTTTGATGGTTTCATTGTGACACTCAGCCTGGTAGAACTTGGCCTTGCCAAT
GTG
GAAGGATTGTCAGTTCTCCGTTCATTTCGACTGCTCCGAGTGTTCAAGTTGGCAAAGTCTTGGCCCA
CA
CTGAATATGCTCATTAAGATCATTGGTAACTCGGTGGGAGCACTGGGCAACCTGACTCTGGTGTTGGC
C
ATCATTGTCTTTATTTTTGCCGTGGTTGGCATGCAGCTGTTTGGAAAAAGTTACAAAGATTGTGTCTGC
AAA
ATTGCCACTGACTGCAAACTCCCACGTTGGCACATGAACGACTTCTTCCACTCGTTCCTGATCGTGT
TC
CGCGTGCTGTGTGGGGAGTGGATAGAGACCATGTGGGACTGCATGGAGGTGGCAGGACAAGCTATGTG
C
CTTACTGTCTTCATGATGGTCATGGTGATTGGGAACCTTGTGGTCTTGAACCTCTTTCTGGCCTTGCTT
CTG
AGCTCATTTAGTGCAGACAACCTTGCAGCCACTGATGATGACAATGAGATGAACAACCTGCAGATTG
CT
GTGGACAGGATGCACAAAGGAATAGCTTATGTAAAAAGAAAAATATATGAATTCATTCAACAATCCTT
T
GTTAAGAAACAGAAGATTCTAGATGAAATTAAGCCACTTGATGATCTAAACAACAGAAAAGACAATTGT
ATC
TCTAACCACACAACAGAAATTGGGAAAGATCTGGACTGTCTGAAAGATGTGAATGGAACCACAAGTG
GC
ATAGGGACGGGCAGCAGTGTGGAGAAGTACATCATTGATGAGAGTGATTATATGTCATTCATAAACAA
C
CCCAGCCTCACTGTGACTGTGCCCATTGCTGTGGGAGAGTCTGACTTTGAGAACTTAAACACAGAAGAC
TTT
AGCAGTGAATCAGATCTAGAAGAAAGCAAAGAGAAACTCAACGAAAGCAGTAGCTCCTCAGAGGGAA
GC
ACAGTAGACATTGGGGCGCCTGCAGAGGAACAGCCTGTCATTGAACCAGAAGAAACCCTTGAGCCCGA
A
GCTTGCTTCACTGAAGGCTGTGTCCAGAGATTCAAGTGCTGTCAAATCAGCGTGGAAGAAGGAAGAGGG
AAA
CAGTGGTGGAACCTACGGAGGACGTGCTTCCGAATAGTTGAACACAACTGGTTTGAGACCTTCATTG
TG
TTCATGATTCTCCTGAGTAGTGGTGCCCTGGCCTTTGAGGATATATATATTGATCAGCGAAAGACGAT
C
AAAACCATGCTGGAGTATGCTGACAAAGTCTTCACTTACATTTTCATCCTGGAGATGCTCCTCAAATGG
GTG
GCCTATGGCTATCAAACATACTTCACCAATGCCTGGTGTTGGCTAGACTTCTTAATTGTTGATGTTT
CA
TTGGTCAGTTTAACAGCAAATGCCTTGGGTTACTCTGAACTCGGGGCCATCAAATCCCTAAGGACACT
A
AGAGCTCTGAGACCCCTAAGAGCCTTATCACGATTTGAAGGGATGAGGGTGGTTGTGAATGCCCTGTTA
GGA
GCAATTCCATCCATCATGAATGTGCTTCTGGTTTGCCTTATATTCTGGCTAATTTTCAGCATCATGG
GC
GTAAATTTGTTTGCTGGCAAATTCTACCACTGTGTTAACACCACAACTGGTGACATATTTGAGATCAG
C
GAAGTCAATAATCATTCTGATTGCCTAAAACTAATAGAAAGAAATGAGACCGCCCGGTGGAAAAATGTG
AAA
GTAAACTTTGATAATGTAGGATTTGGGTATCTTTCTTTGCTTCAAGTTGCCACATTTAAGGGCTGGA
TG
GATATCATGTATGCTGCAGTTGATTCCAGAAATGTTGAACTACAGCCTAAGTATGAGGAAAGCCTGTA
C
ATGTATTTGTACTTCGTCATCTTCATCATCTTCGGGTCCTTCTTTACCCTGAACCTGTTTATTGGTGTC
ATT
ATCGACAATTTCAACCAGCAAAAGAAGAAGTTTGGAGGTCAAGACATCTTTATGACAGAAGAACAGA
AG
AAATACTATAATGCAATGAAGAAATTAGGATCAAAAAAGCCACAAAAGCCTATCCCTCGACCTGGAAA
C
AAATTTCAAGGAATGGTTTTTGACTTTGTAACCAGACAAGTGTTTGATATCAGCATCATGATCCTCATC
TGT
CTGAACATGGTGACCATGATGGTGGAAACGGATGACCAGAGCGATTATGTGACAAGCATTTTGTCAC
GC
ATCAACCTGGTGTTCATCGTCCTGTTCACCGGCGAGTGTGTGCTCAAGCTCATCTCGCTCCGCCATTA
T
TATTTCACCATTGGATGGAACATTTTCGATTTTGTGGTGGTCATCCTCTCCATTGTAGGGATGTTTCTT
GCG
GAGCTAATAGAAAAGTATTTTGTGTCTCCTACCCTGTTCCGAGTCATCCGCCTGGCCAGGATTGGAC
GA
ATCCTACGCCTGATCAAAGGTGCCAAGGGGATCCGCACGCTGCTCTTTGCTCTGATGATGTCCCTTCC
T
GCGCTGTTTAACATCGGCCTCCTGCTTTTTCTCGTCATGTTCATCTACGCCATCTTTGGGATGTCCAAC
TTT
GCCTATGTTAAGAGGGAAGTTGGGATTGATGACATGTTCAACTTTGAGACCTTCGGCAACAGCATGA
TC
TGCCTGTTCCAAATCACCACCTCTGCGGGCTGGGATGGACTGCTGGCCCCCATCCTCAACAGCAAACC
C
CCTGACTGTGACCCTAATAAAGTTAACCCTGGAAGCTCGGTGAAGGGAGACTGTGGGAACCCATCTGTG
GGG
ATTTTCTTTTTTGTCAGCTACATCATCATATCCTTCCTGGTTGTGGTGAACATGTACATTGCTGTCA
TC
CTGGAGAACTTCAGCGTTGCCACAGAAGAAAGTGCAGAGCCTCTGAGTGAGGACGACTTTGAGATGTT
C
TACGAGGTCTGGGAGAAGTTCGACCCTGACGCCACCCAGTTCATGGAATTTGAAAAATTATCTCAGTTT
GCA
GCTGCTCTAGAACCCCCTCTCAATTTGCCACAACCAAACAAACTTCAGCTCATTGCCATGGACCTGC
CC
ATGGTGAGTGGAGACCGCATCCACTGCCTGGACATCTTATTTGCTTTTACAAAGCGGGTGTTGGGTGA
G
AGTGGAGAGATGGATGCTCTTCGAATCCAGATGGAAGAGCGGTTCATGGCTTCCAACCCCTCCAAGGTC
TCT
TATCAGCCCATCACTACTACATTAAAACGCAAACAAGAGGAGGTGTCAGCTGTTATCATTCAGCGAG
CT
TATAGGCGCCACCTTTTGAAGCGAACAGTAAAACAAGCTTCATTCACATACAATAAGAACAAACTCAA
A
GGTGGGGCTAATCTTCTTGTAAAAGAAGACATGCTCATTGACAGAATAAACGAAAACTCTATTACGGAG
AAA
ACTGACCTGACAATGTCCACAGCAGCTTGTCCGCCCTCCTACGATCGGGTGACAAAGCCAATCGTGG
AG
AAACACGAGCAGGAAGGGAAGGATGAAAAAGCCAAAGGGAAATGA


Translation (1998 aa):
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPP
E
MVSEPLEDLDPYYINKK
TFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHSLFSMLIMCTILT
N
CVFMTMSNPPDWTKNV
EYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLG
N
VSALRTFRVLRALKTISVIP
GLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQW
P
PTNASLEEHSIEKNITMDYNGTLVNETVFEFDWKSYIQDS
RYHYFLEGVLDALLCGNSSDAGQCPEGYM
C
VKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQL
TLRAAGKTYMIFFVLVIFLGSFYLINLILA
V
VAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEAAQ
QAAATTASEHSREPSAAGRLSDSSSEASKLS
S
KSAKERRNRRKKRKQKEQSGGEEKDDDEFHKSESEDSIRRKGFRFSIEGNRLTYEKRYSSPHQ
SLLSIR
G
SLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSR
M
LAVFPANGKMHSTVDCNGVVSLVGGPSVPTSPVGQLLPE
GTTTETEMRKRRSSSFHVSMDFLEDPSQRQ
R
AMSIASILTNTVE
ELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHIVNLVVMDPFVDLAITICIVLN
T
LFMAMEHYPMTEHFNHVLTVGNL
VFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLAN
V
EGLSVLRSFRL
LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVC
K
IATDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMVMVIGNLV
VLNLFLALL
L
SSFSADNLAATDDDNEMNNLQIAVDRMHKGIAYVKRKIYEFIQQSFVKKQKILDEIKPLDDLNNRKDNC
I
SNHTTEIGKDLDCLKDVNGTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTED
F
SSESDLEESKE
KLNESSSSSEGSTVDIGAPAEEQPVIEPEETLEPEACFTEGCVQRFKCCQISVEEGRG
K
QWWNLRRTCFRIVEHNWFETFIVFMILLSSGAL
AFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKW
V
AYGYQTYFTNAWCWLDFLIVD
VSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALL
G
AIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTTGDIFEISEVNNHSDCLKLIERNETARWKNV
K
VNFDNVGFGYLSLLQV
ATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGV
I
IDNFNQQKKK
FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILI
C
LNMVTMMVETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIV
GMFL
A
ELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSN
F
AYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVKGDCGNPSV
G
IFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFMEFEKLSQF
A
AALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKV
S
YQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQASFTYNKNKLKGGANLLVKEDMLIDRINENSITE
K
TDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser