NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37968.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37968.1 Public Mus musculus 19 Ppp1r3c 16 104 75 CCDS HistoryNCBI Gene:53412Re-query CCDS DB by CCDS ID:37968.1Re-query CCDS DB by GeneID:53412

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 37968.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000087321 ENSMUSP00000084578 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000087321Link to Ensembl Protein Viewer:ENSMUSP00000084578Re-query CCDS DB by Nucleotide ID:ENSMUST00000087321Re-query CCDS DB by Protein ID:ENSMUSP00000084578
Original member Current member NCBI NM_016854.2 NP_058550.1 Accepted alive Link to Nucleotide Sequence:NM_016854.2Link to Protein Sequence:NP_058550.1Re-query CCDS DB by Nucleotide ID:NM_016854Re-query CCDS DB by Protein ID:NP_058550Link to BLink:NP_058550.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058550.1 317 Q7TMB3 317 100% 0 0

Chromosomal Locations for CCDS 37968.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

Chromosome Start Stop Links
19 36733415 36734354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 36736553 36736566 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGAGCTGCACCAGAATGATCCATGTGCTAGATCCACGTCCTTTGACAAGTTCCGTCATGCCCGTGGACA
TG
GCCATGAGGATTTGCTTGGCTCATTCACCACCTCTGAAGAGTTTCCTGGGTCCTTACAATGGTTTTCA
A
CGAAGAAATTTTGTGAATAAATTGAAACCTTTGAAACCATGTCTCAGTGTCAAGCAGGAAGCCAAATCG
CAG
AGTGAGTGGAAGAGCCCACACAACCAAGCCAAGAAGCGGGTCGTGTTTGCGGACTCCAAGGGGCTGT
CA
CTCACTGCTATCCATGTCTTCTCCGACCTTCCAGAAGAACCAGCGTGGGACCTGCAGTTTGATCTCTT
G
GACCTTAACGATATCTCCTCCAGCTTAAAACTTCACGAGGAGAAAAATTTGGTTTTTGATTTTCCCCAG
CCC
TCAACCGACTACTTAAGTTTCCGGGACCGCTTTCAGAAGAACTTTGTCTGCCTCGAGAACTGCTCTT
TG
CAAGATCGGACGGTGACCGGGACAGTGAAAGTGAAGAATGTGAGCTTTGAGAAGAAGGTTCAGGTCCG
G
ATCACCTTTGACACCTGGAAAACCTACACAGATGTGGACTGTGTCTACATGAAGAATGTTTACAGCAGC
TCA
GACAGCGACACCTTCTCCTTTGCCATCGACTTGCCCCGTGTCATTCCAACTGAGGAGAAAATTGAGT
TC
TGCATTTCTTATCACGCTAATGGGAGGATCTTCTGGGACAACAATGAGGGTCAGAATTACAGAATTGT
C
CATGTGCAATGGAAACCTGACGGAGTGCAGACTCAGGTGGCACCCAAAGACTGTGCATTCCAACAGGGG
CCC
CCTAAGACTGAGATAGAGCCCACAGTCTTTGGCAGTCCAAGGCTTGCTAGCGGCCTCTTCCCAGAGT
GG
CAGAGCTGGGGGAGAGTGGAGAACTTGACCTCCTATCGATGA


Translation (317 aa):
MSCTRMIHVLDPRPLTSSVMPVDMAMRICLAHSPPLKSFLGPYNGFQRRNFVNKLKPLKPCLSVKQEAKS
Q
SEWKSPHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSSLKLHEEKNLVFDFPQ
P
STDYLSFRDRFQKNFVCLENCSLQDRTVTGTVKVKNVSFEKKVQVRITFDTWKTYTDVDCVYMKNVYSS
S
DSDTFSFAIDLPRVIPTEEKIEFCISYHANGRIFWDNNEGQNYRIVHVQWKPDGVQTQVAPKDCAFQQG
P
PKTEIEPTVFGSPRLASGLFPEWQSWGRVENLTSYR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser