NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37624.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37624.2 Public Mus musculus 17 Runx2 16 104 75 CCDS HistoryNCBI Gene:12393Re-query CCDS DB by CCDS ID:37624.2Re-query CCDS DB by GeneID:12393See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Public Note for CCDS 37624.1
The coding region has been updated to shorten the N-terminus to one that is more supported by the available publication data, including PMIDs 9632804, 10524201, 11485310 and 11723115.

Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 37624.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113571 ENSMUSP00000109201 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113571Link to Ensembl Protein Viewer:ENSMUSP00000109201Re-query CCDS DB by Nucleotide ID:ENSMUST00000113571Re-query CCDS DB by Protein ID:ENSMUSP00000109201
Original member Current member EBI,WTSI ENSMUST00000159943 ENSMUSP00000124918 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159943Link to Ensembl Protein Viewer:ENSMUSP00000124918Re-query CCDS DB by Nucleotide ID:ENSMUST00000159943Re-query CCDS DB by Protein ID:ENSMUSP00000124918
Original member Current member EBI,WTSI OTTMUST00000084309 OTTMUSP00000045416 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084309Link to Vega Protein Viewer:OTTMUSP00000045416Re-query CCDS DB by Nucleotide ID:OTTMUST00000084309Re-query CCDS DB by Protein ID:OTTMUSP00000045416
Original member Current member NCBI NM_001146038.2 NP_001139510.1 Accepted alive Link to Nucleotide Sequence:NM_001146038.2Link to Protein Sequence:NP_001139510.1Re-query CCDS DB by Nucleotide ID:NM_001146038Re-query CCDS DB by Protein ID:NP_001139510Link to BLink:NP_001139510.1
Original member Current member NCBI NM_001271627.1 NP_001258556.1 Accepted alive Link to Nucleotide Sequence:NM_001271627.1Link to Protein Sequence:NP_001258556.1Re-query CCDS DB by Nucleotide ID:NM_001271627Re-query CCDS DB by Protein ID:NP_001258556Link to BLink:NP_001258556.1
Original member Current member NCBI NM_009820.5 NP_033950.2 Accepted alive Link to Nucleotide Sequence:NM_009820.5Link to Protein Sequence:NP_033950.2Re-query CCDS DB by Nucleotide ID:NM_009820Re-query CCDS DB by Protein ID:NP_033950Link to BLink:NP_033950.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139510.1 528 Q08775-5 528 100% 0 0
NP_001258556.1 528 Q08775-5 528 100% 0 0
NP_033950.2 528 Q08775-5 528 100% 0 0

Chromosomal Locations for CCDS 37624.2

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 44607905 44608383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44610028 44610093 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44639665 44639826 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44658519 44658692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44717192 44717296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44724745 44724901 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44735233 44735618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44814169 44814226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1587 nt):
ATGGCGTCAAACAGCCTCTTCAGCGCAGTGACACCGTGTCAGCAAAGCTTCTTTTGGGATCCGAGCACCA
GC
CGGCGCTTCAGCCCCCCCTCCAGCAGCCTGCAGCCCGGCAAGATGAGCGACGTGAGCCCGGTGGTGGC
T
GCGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAACAACAGCAACAGCAACAACAG
CAG
CAGCAGCAGCAGCAGCAGGAGGCGGCCGCAGCAGCAGCGGCGGCAGCGGCGGCGGCAGCAGCGGCGG
CG
GCCGCAGTGCCCCGATTGAGGCCGCCGCACGACAACCGCACCATGGTGGAGATCATCGCGGACCACCC
G
GCCGAACTGGTCCGCACCGACAGTCCCAACTTCCTGTGCTCCGTGCTGCCCTCGCACTGGCGGTGCAAC
AAG
ACCCTGCCCGTGGCCTTCAAGGTTGTAGCCCTCGGAGAGGTACCAGATGGGACTGTGGTTACCGTCA
TG
GCCGGGAATGATGAGAACTACTCCGCCGAGCTCCGAAATGCCTCCGCTGTTATGAAAAACCAAGTAGC
C
AGGTTCAACGATCTGAGATTTGTGGGCCGGAGCGGACGAGGCAAGAGTTTCACCTTGACCATAACAGTC
TTC
ACAAATCCTCCCCAAGTGGCCACTTACCACAGAGCTATTAAAGTGACAGTGGACGGTCCCCGGGAAC
CA
AGAAGGCACAGACAGAAGCTTGATGACTCTAAACCTAGTTTGTTCTCTGATCGCCTCAGTGATTTAGG
G
CGCATTCCTCATCCCAGTATGAGAGTAGGTGTCCCGCCTCAGAACCCACGGCCCTCCCTGAACTCTGCA
CCA
AGTCCTTTTAATCCACAAGGACAGAGTCAGATTACAGATCCCAGGCAGGCACAGTCTTCCCCACCGT
GG
TCCTATGACCAGTCTTACCCCTCCTATCTGAGCCAGATGACATCCCCATCCATCCACTCCACCACGCC
G
CTGTCTTCCACACGGGGCACCGGGCTACCTGCCATCACTGACGTGCCCAGGCGTATTTCAGATGATGAC
ACT
GCCACCTCTGACTTCTGCCTCTGGCCTTCCTCTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAAC
TG
GGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCC
A
CGAATGCACTACCCAGCCACCTTTACCTACACCCCGCCAGTCACGTCAGGCATGTCCCTCGGCATGTCC
GCC
ACCACTCACTACCACACGTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGACCCT
TC
CAGACCAGCAGCACTCCATATCTCTACTATGGTACTTCGTCAGCATCCTATCAGTTCCCAATGGTACC
C
GGGGGAGACCGGTCTCCTTCCAGGATGGTCCCACCATGCACCACCACCTCGAATGGCAGCACGCTATTA
AAT
CCAAATTTGCCTAACCAGAATGATGGTGTTGACGCTGACGGAAGCCACAGCAGTTCCCCAACTGTTT
TG
AATTCTAGCGGCAGAATGGATGAGTCTGTTTGGCGGCCATATTGA


Translation (528 aa):
MASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQ
Q
QQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCN
K
TLPVAFK
VVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITV
F
TNPPQVATYHRAIKVTVDGPREPR
RHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSA
P
SPFNPQGQSQIT
DPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDD
T
ATSDFCLWPSSLSKKSQA
GASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMS
A
TTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLL
N
PNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser