NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36647.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36647.1 Public Mus musculus 13 Dtnbp1 16 104 75 CCDS HistoryNCBI Gene:94245Re-query CCDS DB by CCDS ID:36647.1Re-query CCDS DB by GeneID:94245

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36647.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000072329 ENSMUSP00000072170 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072329Link to Ensembl Protein Viewer:ENSMUSP00000072170Re-query CCDS DB by Nucleotide ID:ENSMUST00000072329Re-query CCDS DB by Protein ID:ENSMUSP00000072170
Original member Current member NCBI NM_025772.4 NP_080048.2 Accepted alive Link to Nucleotide Sequence:NM_025772.4Link to Protein Sequence:NP_080048.2Re-query CCDS DB by Nucleotide ID:NM_025772Re-query CCDS DB by Protein ID:NP_080048Link to BLink:NP_080048.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080048.2 352 Q91WZ8-1 352 100% 0 0

Chromosomal Locations for CCDS 36647.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

Chromosome Start Stop Links
13 44922207 44922454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44923149 44923292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44930996 44931151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44953172 44953194 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44970046 44970178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44982741 44982873 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44986035 44986095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44992019 44992069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 44993685 44993738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 45001917 45001972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1059 nt):
ATGCTGGAGACCCTGCGCGAGCGGCTGCTGAGCGTACAGCAGGATTTCACCTCCGGGCTGAAGACTTTAA
GT
GATAAGTCAAGAGAAGCAAAAGTGAAAGGCAAACCCAGGACTGCTCCACGCTTACCGAAGTACTCTGC
T
GGACTAGAATTACTTAGCAGGTATGAGGATGCGTGGGCTGCACTTCACAGAAGAGCCAAGGAGTGTGCA
GAC
GCTGGCGAGCTGGTGGACAGCGAGGTGGTCATGCTGTCTGCCCACTGGGAGAAGAAGAGGACCAGCC
TG
AACGAGCTGCAGGGGCAGCTGCAGCAGCTGCCCGCTCTCCTGCAGGACTTGGAGTCTCTGATGGCAAG
C
CTGGCTCATTTAGAGACAAGTTTTGAAGAGGTAGAGAACCATTTGCTGCACCTGGAGGACTTGTGTGGG
CAG
TGTGAGTTAGAAAGACACAAGCAGGCCCAGGCCCAACACCTGGAGAGCTACAAGAAAAGTAAGAGGA
AG
GAGCTTGAAGCCTTCAAAGCTGAACTCGATACAGAGCACACACAGAAGGCCCTGGAAATGGAGCACAC
C
CAGCAACTGAAGCTGAAGGAGCGGCAGAAGTTCTTCGAGGAAGCCTTCCAGCAGGACATGGAACAGTAC
CTG
TCCACGGGCTACCTGCAGATCGCAGAGAGGCGAGAGCCTATGGGCAGCATGTCATCCATGGAAGTGA
AT
GTGGACGTGCTGGAGCAGATGGACCTGATGGACATCTCAGACCAGGAGGCTCTCGATGTCTTCCTGAA
C
TCCGGCGGAGAGGACAACATTGTGATGTCCCCTGGTGTGGAGATGGAATCCAACCCCAATCAGAATGAA
ATG
AGTCTTCAGATTCCAAGTCCCTCAGAATCAGCATCCCAGCCACCTGCCTCACCCTCTGCCTGCACTG
AC
CTGGACACTGCTGATGCCCCCCTCATCCAGTCTGATGAGGAGGAGGTACAGGTGGACACGGCCTTGGT
C
ACATTACACACTGACAGAAAGTCCACCCCAGGTGTCAGTGATGACAGTGACCAGTGTGACTCAACTCAG
GAC
ATTTAA


Translation (352 aa):
MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKGKPRTAPRLPKYSAGLELLSRYEDAWAALHRRAKECA
D
AGE
LVDSEVVMLSAHWEKKRTSLNELQGQLQQLPALLQDLESLMASLAHLETSFEEVENHLLHLEDLCG
Q
CELERHKQAQAQHLESYKKSK
RKELEAFKAELDTEHTQKALEMEHTQQLKLKERQKFFEEAFQQDMEQY
L
STGYLQIAERR
EPMGSMSSMEVNVDVLEQMDLMDISDQEALDVFLNSGGEDNIVMSPGVEMESNPNQNE
M
SLQIPSPSESASQPPASPSACTDLDTADAPLIQSDEEEVQVDTALVTLHTDRKSTPGVSDDSDQCDSTQ
D
I




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser