NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36603.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36603.1 Public Mus musculus 13 Gli3 16 104 75 CCDS HistoryNCBI Gene:14634Re-query CCDS DB by CCDS ID:36603.1Re-query CCDS DB by GeneID:14634

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36603.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110510 ENSMUSP00000106137 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110510Link to Ensembl Protein Viewer:ENSMUSP00000106137Re-query CCDS DB by Nucleotide ID:ENSMUST00000110510Re-query CCDS DB by Protein ID:ENSMUSP00000106137
Original member Current member EBI,WTSI OTTMUST00000059816 OTTMUSP00000029127 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059816Link to Vega Protein Viewer:OTTMUSP00000029127Re-query CCDS DB by Nucleotide ID:OTTMUST00000059816Re-query CCDS DB by Protein ID:OTTMUSP00000029127
Original member Current member NCBI NM_008130.2 NP_032156.2 Accepted alive Link to Nucleotide Sequence:NM_008130.2Link to Protein Sequence:NP_032156.2Re-query CCDS DB by Nucleotide ID:NM_008130Re-query CCDS DB by Protein ID:NP_032156Link to BLink:NP_032156.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032156.2 1583 Q61602 1583 100% 0 0

Chromosomal Locations for CCDS 36603.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

Chromosome Start Stop Links
13 15478041 15478164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15548400 15548642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15613779 15613884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15641069 15641274 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15644294 15644440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15648521 15648722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15659962 15660175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15660881 15660994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15662390 15662530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15713499 15713648 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15714950 15715114 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15720055 15720345 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15723440 15723767 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 15724461 15726781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4752 nt):
ATGGAGGCCCAGGCCCACAGCTCTACGGCGACTGAGAGGAAGAAAGCTGAAAATTCCATTGGGAAATGTC
CC
ACGAGAACAGATGTCAGCGAGAAGGCCGTGGCCTCTAGTACCACTTCCAATGAGGATGAAAGTCCTGG
A
CAGATCTATCACCGAGAGAGAAGAAACGCAATCACTATGCAGCCTCAGAGTGTGCAGGGTCTCAACAAA
ATC
AGTGAGGAGCCCTCGACGTCTAGTGATGAGAGGGCCTCGCTGATCAAGAAAGAGATCCATGGCTCTC
TA
CCACATCTGGCGGAGCCCTCTCTCCCTTACCGTGGGACTGTGTTTGCCATGGATCCCCGGAATGGCTA
C
ATGGAGCCTCACTACCACCCTCCTCATCTTTTCCCTGCCTTCCATCCTCCTGTACCAATTGATGCCAGA
CAT
CATGAGGGCCGTTACCATTATGATCCATCTCCTATTCCTCCATTACATGTGCCTTCTGCCTTATCTA
GT
AGCCCGACGTATCCAGACTTGCCCTTCATTAGGATCTCCCCACACCGTAATCCCACTGCAGCCTCAGA
G
TCCCCCTTCAGCCCCCCACACCCCTACATCAACCCATATATGGACTACATCCGCTCATTGCACAGCAGC
CCA
TCCCTCTCCATGATCTCTGCTGCCCGAGGGCTGAGCCCTACAGATGCTCCCCATGCTGGAGTCAGCC
CT
GCGGAATACTATCACCAGATGGCTCTGCTGACAGGCCAGCGCAGCCCTTATGCAGACATCCTTCCCTC
A
GCTGCCACTGCTGGTGCAGGGGCCATCCATATGGAGTACCTTCATGCCATGGACAGCACCAGATTTCCC
AGC
CCTAGGCTGTCAGCTAGGCCCAGCCGAAAGCGCACACTGTCAATATCGCCACTGTCAGATCATAGCT
TC
GACCTTCAGACCATGATAAGAACATCCCCTAACTCCTTGGTTACAATCCTCAATAATTCCCGTAGCAG
C
TCTTCAGCAAGTGGTTCCTATGGGCACTTATCGGCAAGTGCAATCAGCCCTGCATTGAGCTTCACCTAC
CCC
TCCGCTCCTGTGTCTCTTCACATGCATCAACAGATCCTAAGCCGACAGCAAAGCTTAGGCTCCGCAT
TC
GGACACAGCCCTCCTCTCATCCACCCTGCTCCAACATTTCCAACACAGAGACCTATCCCTGGGATTCC
G
ACAGTTCTGAACCCCGTCCAGGTCAGCTCTGGCCCTTCTGAGTCCTCACAGAGCAAGCCCACAAGCGAG
TCT
GCAGTGAGCAGCACTGGTGACCCTATGCATAATAAGCGGTCCAAGATCAAGCCTGATGAAGACCTCC
CC
AGCCCAGGGTCACGGGGCCAGCAGGAACAGCCGGAAGGAACAACCCTAGTCAAGGAGGAAGCGGACAA
A
GATGAAAGCAAGCAGGAGCCTGAAGTCATCTACGAGACAAACTGCCACTGGGAAGGCTGCACCAGAGAG
TTC
GACACCCAAGATCAGCTTGTGCATCATATCAATAATGACCACATTCATGGAGAAAAGAAGGAGTTCG
TG
TGCCGCTGGCTTGATTGTTCACGAGAGCAGAAACCGTTCAAAGCCCAGTACATGTTGGTAGTGCATAT
G
AGAAGACACACTGGGGAGAAGCCTCACAAATGTACATTTGAAGGTTGCACAAAAGCCTACTCAAGACTC
GAA
AACCTGAAAACCCACTTGAGATCTCACACTGGAGAGAAGCCATACGTCTGTGAGCATGAGGGCTGCA
AC
AAGGCTTTCTCTAATGCTTCAGATCGGGCCAAGCACCAAAACAGAACACATTCCAATGAGAAACCGTA
T
GTATGCAAAATCCCTGGCTGCACCAAGCGTTACACAGACCCCAGCTCTCTCCGGAAACACGTGAAGACT
GTG
CATGGCCCTGAGGCTCATGTTACCAAGAAGCAGCGTGGGGACATGCACCCTCGGCCTCCACCCCCGA
GA
GATTCCGGCAGCCATTCACAGTCCAGGTCCCCTGGCCGGCCAACTCAGGGAGCATTTGGTGAGCAGAA
G
GAGCTGAGCAACACTACCTCAAAGCGGGAAGAGTGCCTCCAGGTGAAGACTGTCAAGGCTGAGAAGCCC
ATG
ACATCTCAGCCAAGCCCTGGTGGTCAGTCTTCATGCAGCAGCCAACAGTCCCCCATCAGCAACTATT
CC
AACAGTGGGCTCGAGCTTCCTCTGACTGATGGAGGTAGTGTAGCAGACCTCAGTGCCATCGATGAAAC
C
CCAATCATGGACTCGACCATTTCCACGGCAACCACAGCCCTTGCTTTGCAAGCCAGGAGAAACCCGGCA
GGG
ACCAAATGGATGGAGCACATCAAACTTGAAAGGCTAAAACAAGTGAATGGAATGTTTCCAAGACTGA
AC
CCTATTCTACCCTCCAAAGCCCCTGCGGTATCTCCTCTCATAGGAAATGGCACACAGTCCAATAACAA
C
TATAGCTCGGGTGGGCCCGGGACCCTCCTCCCGAGCAGAAGTGACCTGTCAGGTGTAGACTTCACAGTG
CTG
AACACACTCAACAGGAGAGACAGCAATACCAGCACTATCAGCTCTGCCTACCTGAGCAGCCGCAGAT
CC
TCGGGCATCTCCCCCTGCTTTTCCAGCCGCAGGTCCAGCGAGGCGTCCCAGGCTGAAGGGCGACCCCA
G
AATGTGAGTGTGGCTGACTCCTACGATCCCATCTCCACAGATGCTTCAAGGAGGTCCAGCGAGGCCAGC
CAG
GGTGACGGGCTGCCCAGTCTGCTCAGCCTCACACCCGTGCAGCAGTACCGCCTTAAGGCCAAGTATG
CA
GCTGCCACAGGTGGCCCACCACCCACACCTCTGCCCCACATGGAGAGGCTGAGCCTGAAGACCAAGAT
G
GCCTTGCTAGGGGAAGGGAGGGACTCTGGGGTGACCCTGCCTCCAGTCCATCCTCCTCGAAGATGCAGT
GAT
GGGGGAGGTCACACATACAGAGGGCGTCACCTGATGCCTCATGATGCACTAGCGAACAGTGTGAGGA
GA
GCCAGCGACCCTGTGAGGACAGTCTCGGAGAACATGTCACTTGCCAGGGTTCAACGCTTCAGCAGCCT
C
AATAGCTTTAATCCTCCAAATTTGCCTCCATCGGTGGAAAAGCGTAGCTTAGTGCTGCAAAATTATACC
CGG
CAGGAGAGCAGCCAACCCCGGTACTTCCAGGCATCCCCTTGCCCTCCCAGCATCACAGAGAATGTTG
CC
CTGGAGGCTCTGACCATGGATGCTGATGCTAACTTGAATGATGAAGACCTCCTGCCAGATGATGTGGT
A
CAGTATTTAAATTCCCAGAACCAAACAGGGTATGGGCAGCAGTTGCAGAGTGGCATCTCTGAAGACAGC
AAA
GTAGCCCATGAGCCAGAGGACTTGGACTTAGCAGGGCTGCCAGACAGTCATGTTGGCCAGGAGTACC
CA
GCTCTGGAGCAGCCCTGCTCTGAGGGCAGTAAAACTGATTTGCCCATCCAGTGGAACGAGGTCAGTTC
T
GGAACTTCTGATCTGTCATCCTCCAAGCTGAAGTGTGGTCAGCAGCGCCCTAGCGCACAGCAGCCTCGG
GGT
TTTGGGCTATACAACAATATGGTGGTACACCCACATAATCTGTGGAAGGTTGGCACTGGCCCAGCTG
GG
GGATATCAGACCCTCGGGGAGAATAGCAGTACCTACAATGGCCCAGAGCACTTTGCAATCCACAGTGG
G
GATGGACTTGGCACCAATGGAAATACTTTCCATGAACAGCCCTTTAAGACCCAGCAGTATGGGAGCCAG
CTC
AACAGGCAGCCACTGACTTCCAGTGCTCTAGATCATGCCTGTGGTACAGGGATTCAAGGGTCCAAGC
TA
AAAGGCAACAGCTTGCAAGAGAATGGGGGTTTGCTAGATTTCAGCCTGTCCGTGGCACCAAATGAGTT
A
GCTGGCAACACAGTGAATGGCATGCAAACCCAAGATCAAATGGGACAGGGATACATTGCCCATCAGCTA
CTC
AGTGGCAGCATGCAACACCAGGGGCCCAGCCGCCCTGGTCAACAGGTACTAGGGCAGGTTGGTGCTA
CC
TCACATATCAACATCTATCAAGGGACAGAGAGCTGCCTACCAGGGACTCAGGACAACAGCAGCCAGCC
A
TCAAGCATGGCAGCTATCAGGGGCTACCAGCCCTGTGCCAGCTATGGGGGTAACAGGCGTCAGGCAATG
CCA
AGGGGCAACCTCACTCTGCAACAAGGACAGCTCAGTGACATGAGTCAGAGCAGCAGGGTGAACAGCA
TC
AAAATGGAGGCACAAGGTCAGTCCCAGCAGCTCTGCTCTACCGTGCAGAATTATTCCGGTCAGTTCTA
T
GACCAAACCATGGGCTTCAGTCAGCAAGACAGGAAAGCTGGCTCGTTCTCCCTCTCAGATGCCAACTGC
CTG
CTCCAAGGGAATGGCACTGAAAACTCTGAGTTACTCTCCCCAGGTGCTAACCAGGTAACAAGCACAG
TT
GACAGCTTTGAGAGTCATGACCTAGAAGGTGTGCAGATTGATTTTGATGCCATCATAGATGATGGGGA
C
CATACCAGCCTAATGTCAGGGGCCTTGAGCCCAAGTATTATTCAGAACCTTTCCCACAGCTCCTCCCGT
CTC
ACCACTCCGCGGGCATCCCTCCCATTCCCATCCCTATCCATGGGCACCACCAACATGGCTATCGGGG
AT
ATGAGTTCTTTGCTGACCTCCCTTGCAGAAGAAAGCAAGTTCCTTGCAGTTATGCAGTAG


Translation (1583 aa):
MEAQAHSSTATERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQIYHRERRNAITMQPQSVQGLNK
I
SEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEPHY
HPPHLFPAFHPPVPIDAR
H
HEGRYHYDPSPIPPLH
VPSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSS
P
SLSMISAARGLSPTD
APHAGVSPAEYYHQMALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFP
S
PRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAI
SPALSFTY
P
SAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQ
SKPTSE
S
AVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQ
EQPEGTTLVKEEADKDESKQEPEVIYETNCHWEGCTRE
F
DTQDQLVH
HINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRL
E
NLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNE
KPYVCKIPGCTKRYTDPSSLRKHVKT
V
HGPEAHVTKKQRGDMHPRPPPPRDSGSHSQSRSPGRPTQGAFGEQKELSNTTSKREECLQVKTVKAEKP
M
TSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSVADLSAIDETPIMDSTISTATTALALQARRNPA
G
TKWMEHIKLERLKQVNGMFPRLNPILPSKAPAVSPLIGN
GTQSNNNYSSGGPGTLLPSRSDLSGVDFTV
L
NTLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEAS
Q
GDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMERLSLKTKMALLGEGRDSGVTLPPVHPPRRCS
D
GGGHTYRGRHLMPHDALANSVRRASDPVRTVSENMSLARVQRFSSLNSFNPPNLPPSVEKRSLVLQNYT
R
QESSQPRYFQASPCPPSITENVALEALTMDADANLNDEDLLPDDVVQYLNSQNQTGYGQQLQSGISEDS
K
VAHEPEDLDLAGLPDSHVGQEYPALEQPCSEGSKTDLPIQWNEVSSGTSDLSSSKLKCGQQRPSAQQPR
G
FGLYNNMVVHPHNLWKVGTGPAGGYQTLGENSSTYNGPEHFAIHSGDGLGTNGNTFHEQPFKTQQYGSQ
L
NRQPLTSSALDHACGTGIQGSKLKGNSLQENGGLLDFSLSVAPNELAGNTVNGMQTQDQMGQGYIAHQL
L
SGSMQHQGPSRPGQQVLGQVGATSHINIYQGTESCLPGTQDNSSQPSSMAAIRGYQPCASYGGNRRQAM
P
RGNLTLQQGQLSDMSQSSRVNSIKMEAQGQSQQLCSTVQNYSGQFYDQTMGFSQQDRKAGSFSLSDANC
L
LQGNGTENSELLSPGANQVTSTVDSFESHDLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSR
L
TTPRASLPFPSLSMGTTNMAIGDMSSLLTSLAEESKFLAVMQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser