NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36539.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36539.1 Public Mus musculus 12 Dicer1 16 104 75 CCDS HistoryNCBI Gene:192119Re-query CCDS DB by CCDS ID:36539.1Re-query CCDS DB by GeneID:192119See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36539.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041987 ENSMUSP00000043676 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041987Link to Ensembl Protein Viewer:ENSMUSP00000043676Re-query CCDS DB by Nucleotide ID:ENSMUST00000041987Re-query CCDS DB by Protein ID:ENSMUSP00000043676
Original member Current member NCBI NM_148948.2 NP_683750.2 Accepted alive Link to Nucleotide Sequence:NM_148948.2Link to Protein Sequence:NP_683750.2Re-query CCDS DB by Nucleotide ID:NM_148948Re-query CCDS DB by Protein ID:NP_683750Link to BLink:NP_683750.2

Chromosomal Locations for CCDS 36539.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 104691593 104691758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104692127 104692202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104692303 104692465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104694478 104694746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104696274 104697144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104700365 104700520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104702402 104703182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104704066 104704241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104704719 104704824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104705053 104705235 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104706213 104706366 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104706551 104706764 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104706853 104707032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104708776 104708915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104709785 104709860 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104710625 104710757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104712181 104712335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104712995 104713237 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104714774 104714906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104721971 104722443 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104723902 104724070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104728333 104728493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104729128 104729262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104730133 104730263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104731020 104731182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 104731800 104731913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5721 nt):
ATGGCAGGCCTGCAGCTCATGACCCCTGCTTCCTCACCAATGGGTCCTTTCTTTGGACTGCCATGGCAAC
AA
GAAGCAATTCATGATAACATTTATACGCCAAGAAAATACCAGGTTGAGCTGCTGGAAGCAGCTCTGGA
C
CATAACACAATTGTGTGCTTGAACACTGGCTCAGGGAAGACGTTCATCGCGGTCCTGCTCACCAAAGAG
CTG
GCCCATCAGATCAGGGGCGACCTCAACCCGCATGCAAAAAGGACCGTGTTCCTCGTCAACTCTGCAA
AC
CAGGTTGCTCAACAAGTGTCAGCCGTCAGAACTCACTCGGATCTCAAGGTTGGAGAGTACTCAGACCT
A
GAAGTAAATGCATCTTGGACAAAAGAGAGATGGAGCCAAGAGTTTACTAAGCACCAGGTTCTCATTATG
ACT
TGCTATGTCGCCTTGACTGTTTTGAAAAATGGTTACTTATCACTGTCAGACATTAACCTTTTGGTGT
TT
GATGAGTGTCATCTTGCGATTCTAGACCACCCCTATCGTGAAATTATGAAGCTCTGTGAGAGTTGTCC
A
TCATGCCCTCGAATTTTGGGACTAACTGCTTCCATTTTAAATGGGAAATGTGATCCAGAGGAATTGGAA
GAG
AAGATTCAGAAACTGGAGCGAATTCTCAGGAGTGACGCTGAGACGGCGACTGACTTGGTGGTCCTGG
AC
AGATACACTTCTCAGCCTTGTGAGATTGTGGTAGACTGTGGACCGTTTACTGACAGAAGTGGGCTGTA
T
GAGAGATTGCTGATGGAGTTAGAAGCAGCACTTGATTTTATCAATGATTGTAATGTAGCTGTACATTCA
AAG
GAAAGAGATTCTACTTTGATTTCCAAACAAATCCTCTCAGACTGCCGTGCAGTGTTGGTTGTTCTGG
GA
CCCTGGTGTGCAGATAAAGTAGCTGGGATGATGGTAAGAGAACTTCAGAAGTACATCAAACATGAGCA
A
GAGGAGCTACACAGGAAGTTCCTATTGTTTACAGACACCTTGTTAAGGAAAATACACGCCCTGTGTGAA
GAG
TACTTCTCACCTGCCTCACTTGACCTGAAGTATGTAACTCCCAAAGTCATGAAACTGCTCGAGATCC
TG
CGCAAATACAAGCCCTATGAGCGACAGCAGTTTGAAAGTGTTGAGTGGTACAATAACAGGAATCAGGA
T
AATTACGTGTCCTGGAGTGATTCCGAGGATGACGATGATGACGAAGAAATTGAAGAAAAAGAAAAGCCA
GAG
ACAAATTTTCCTTCTCCGTTTACCAATATTTTATGTGGGATTATTTTTGTGGAAAGAAGATACACAG
CA
GTTGTCCTAAACAGATTGATAAAGGAAGCTGGCAAACAAGATCCAGAGCTGGCTTATATCAGCAGCAA
C
TTTATAACTGGACACGGCATTGGAAAGAACCAGCCTCGCAGCAAACAGATGGAGGCGGAGTTCAGAAAG
CAG
GAGGAGGTACTTAGGAAATTTCGAGCTCATGAGACCAACCTGCTCATTGCAACAAGTGTTGTAGAAG
AG
GGTGTGGATATTCCCAAGTGCAATTTGGTGGTTCGTTTTGATTTGCCTACAGAGTATCGATCATATGT
C
CAGTCTAAAGGACGGGCACGAGCGCCGATCTCTAATTACGTAATGTTAGCAGATACAGACAAGATAAAG
AGC
TTTGAAGAAGACCTCAAGACCTACAAAGCTATTGAAAAGATCTTAAGGAACAAGTGTTCGAAGTCAG
CG
GATGGTGCTGAGGCGGACGTCCATGCTGGTGTAGATGATGAGGATGCTTTCCCGCCATATGTGCTGAG
G
CCTGATGATGGGGGTCCTCGAGTCACAATCAACACTGCCATTGGACACATCAACAGATATTGTGCTCGA
TTA
CCAAGTGATCCGTTTACGCATCTAGCTCCCAAATGTAGAACCCGAGAATTGCCTGATGGTACATTTT
AT
TCAACTCTTTATCTTCCGATTAACTCACCTCTTCGAGCCTCCATTGTTGGTCCACCGATGGACAGTGT
A
CGGTTGGCTGAAAGAGTGGTAGCTCTCATTTGCTGTGAAAAACTGCACAAAATTGGTGAACTGGATGAA
CAC
TTGATGCCAGTTGGGAAAGAGACTGTTAAATATGAAGAAGAGCTGGACTTACATGACGAGGAGGAGA
CC
AGTGTTCCCGGGAGACCAGGGTCCACAAAACGACGGCAGTGCTACCCCAAAGCAATTCCAGAGTGCTT
G
AGGGAGAGTTACCCCAAACCCGACCAGCCTTGTTACCTGTATGTGATAGGAATGGTCTTAACTACCCCC
CTC
CCTGATGAACTCAACTTCAGGCGGCGGAAGCTCTACCCACCTGAGGACACCACAAGATGCTTTGGGA
TC
CTGACAGCCAAACCCATACCTCAGATTCCTCACTTTCCTGTGTATACACGCTCTGGAGAGGTCACCAT
A
TCCATCGAGCTGAAGAAGTCTGGTTTCACATTGTCTCAACAAATGCTCGAGCTGATTACAAGATTGCAC
CAG
TACATATTCTCACATATTCTCCGGCTTGAGAAGCCTGCCCTGGAGTTTAAACCTACAGGCGCGGAGT
CA
GCCTACTGTGTTCTACCTCTTAATGTTGTTAATGACTCCGGCACTTTGGACATTGACTTTAAATTCAT
G
GAGGATATTGAGAAGTCGGAAGCTCGGATAGGCATTCCTAGCACCAAGTATTCAAAGGAAACACCGTTT
GTC
TTTAAGTTAGAAGATTACCAAGATGCAGTGATCATTCCAAGATACCGCAATTTTGATCAGCCTCATC
GA
TTTTATGTAGCTGATGTATATACGGATCTTACCCCACTCAGTAAATTTCCTTCCCCTGAATATGAAAC
T
TTTGCAGAATATTATAAAACAAAGTATAACCTTGACCTGACCAATCTCAACCAGCCACTGCTGGATGTT
GAC
CACACATCTTCCAGACTGAACCTTTTGACACCTCGGCATTTGAATCAGAAGGGGAAAGCACTTCCTC
TA
AGCAGTGCTGAGAAGAGGAAGGCCAAATGGGAAAGTCTGCAGAACAAACAGATCCTGGTTCCGGAACT
C
TGTGCTATACATCCAATCCCAGCATCACTGTGGAGAAAAGCGGTTTGTCTCCCCAGCATACTGTATCGC
CTT
CACTGCCTTCTGACTGCAGAGGAACTAAGAGCTCAGACAGCCAGCGATGCTGGTGTGGGTGTCAGAT
CA
CTTCCCGTGGATTTTAGATACCCTAACTTAGACTTCGGGTGGAAAAAATCTATTGATAGCAAGTCTTT
C
ATCTCAAGCTGTAACTCCTCGTTGGCTGAGAGTGATAATTACTGTAAGCACAGCACAACTGTAGTCCCT
GAA
CATGCTGCACATCAAGGTGCTACTAGACCCTCCTTAGAAAACCATGACCAAATGTCTGTGAACTGCA
AA
AGGTTGCCCGCTGAGTCACCTGCTAAGCTCCAAAGTGAGGTTTCAACGGATCTTACAGCAATTAATGG
T
CTTTCTTACAATAAAAACCTTGCCAATGGCAGTTATGATTTAGTTAACAGAGACTTTTGCCAAGGAAAT
CAG
CTGAATTACTTCAAGCAGGAAATACCTGTACAACCAACTACCTCATATCCCATTCAGAATTTGTACA
AT
TATGAGAACCAGCCCAAGCCCAGCAATGAATGTCCTCTACTGAGTAATACGTACCTTGATGGGAACGC
T
AACACATCTACCTCAGATGGAAGCCCCGCGGTGTCCACGATGCCTGCCATGATGAATGCTGTTAAAGCA
CTC
AAGGACAGGATGGACTCTGAGCAGAGCCCTTCTGTTGGGTACTCCTCAAGGACTCTTGGCCCCAATC
CG
GGACTGATTCTCCAGGCTTTGACACTGTCAAATGCCAGTGATGGGTTTAACCTGGAGCGGCTTGAGAT
G
CTTGGCGACTCCTTTTTAAAGCATGCTATCACCACATATCTGTTTTGCACGTACCCTGATGCTCATGAA
GGC
CGCCTTTCATATATGAGAAGCAAAAAGGTCAGCAACTGTAACCTGTATCGCCTTGGCAAGAAGAAGG
GA
CTGCCCAGCCGCATGGTGGTGTCGATATTCGATCCTCCTGTGAATTGGCTTCCTCCTGGTTATGTGGT
A
AACCAAGACAAAAGTAACTCAGAGAAGTGGGAAAAGGATGAAATGACAAAAGACTGCTTGCTGGCTAAT
GGC
AAACTGGGTGAGGCCTGTGAGGAGGAGGAGGACCTGACGTGGAGGGCCCCCAAGGAGGAGGCCGAGG
AT
GAGGACGACTTCCTGGAGTATGACCAGGAGCATATCCAGTTTATAGACAGCATGCTCATGGGCTCGGG
C
GCCTTCGTGAGGAAAATCTCTCTGTCGCCCTTCTCAGCCTCCGACTCTGCATACGAATGGAAGATGCCC
AAG
AAGGCCTCCTTGGGCAGTATGCCGTTTGCCTCGGGCCTTGAGGATTTTGATTACAGCTCTTGGGATG
CG
ATGTGCTATCTGGATCCTAGCAAAGCCGTTGAAGAGGATGACTTTGTGGTAGGTTTCTGGAATCCATC
A
GAAGAGAACTGTGGCGTCGACACAGGGAAGCAGTCCATTTCTTACGACTTGCACACGGAGCAGTGCATT
GCT
GACAAGAGCATAGCGGACTGTGTGGAGGCCCTGCTGGGCTGCTACTTAACCAGCTGCGGCGAGAGGG
CT
GCTCAGCTCTTCCTCTGTTCGCTGGGGCTGAAGGTGCTCCCAGTAATCAAAAGGACCAGCCGGGAGAA
G
GCCTTGGACCCTGCTCAGGAGAACGGAAGCAGCCAACAAAAGAGCCTTTCAGGGAGCTGTGCCTCTCCA
GTT
GGCCCACGCTCCTCTGCAGGGAAAGACTTGGAGTACGGCTGCCTGAAGATCCCACCGAGGTGCATGT
TT
GACCATCCAGACGCAGAGAAAACCCTCAACCACCTGATATCTGGGTTTGAAACTTTTGAGAAGAAAAT
T
AACTATAGATTCAAGAATAAGGCTTATCTTCTGCAGGCTTTTACACACGCCTCCTACCACTACAACACT
ATC
ACTGATTGTTACCAGCGCTTAGAATTCCTGGGAGATGCGATTTTGGACTACCTCATAACCAAGCACC
TT
TATGAAGACCCACGGCAGCATTCTCCAGGGGTCTTGACTGACTTGCGCTCTGCCCTTGTCAATAACAC
C
ATCTTTGCATCATTGGCTGTGAAGTATGACTACCACAAGTACTTTAAAGCTGTCTCTCCTGAGCTCTTT
CAT
GTTATTGATGACTTTGTGAAGTTTCAGCTTGAGAAGAACGAAATGCAAGGAATGGACTCTGAGCTTA
GG
AGATCCGAGGAGGATGAGGAGAAAGAAGAGGATATCGAAGTCCCCAAGGCCATGGGGGACATTTTTGA
G
TCTCTTGCTGGTGCCATTTATATGGACAGTGGGATGTCTCTGGAGGTGGTCTGGCAGGTGTACTATCCG
ATG
ATGCAGCCTCTAATAGAAAAGTTTTCTGCAAATGTGCCTCGTTCTCCAGTGAGAGAATTGCTCGAGA
TG
GAACCAGAAACTGCCAAGTTTAGCCCAGCGGAGAGAACTTATGATGGAAAGGTCAGAGTCACCGTGGA
A
GTGGTGGGAAAGGGGAAATTTAAAGGTGTTGGCCGGAGCTACAGGATCGCCAAGTCTGCTGCAGCACGA
AGG
GCCCTCCGCAGCCTCAAAGCTAACCAGCCTCAGGTTCCTAACAGCTGA


Translation (1906 aa):
MAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKE
L
AHQIRGDLNPHAKRTVFLVNS
ANQVAQQVSAVRTHSDLKVGEYSDLEVNASWTKERWSQEFTKHQVLIM
T
CYVALTVLKNGYLSLSDINLLVFDECHLAILDHPYREIMK
LCESCPSCPRILGLTASILNGKCDPEELE
E
KIQKLERILRSDAETATDLVVLD
RYTSQPCEIVVDCGPFTDRSGLYERLLMELEAALDFINDCNVAVHS
K
ERDSTLISKQ
ILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTLLRKIHALCE
E
YFSPASLDLKYVTPKVMKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDDEEIEEKEKP
E
TNFPSPFTNILCGIIFVERRYTAVVLN
RLIKEAGKQDPELAYISSNFITGHGIGKNQPRSKQMEAEFRK
Q
EE
VLRKFRAHETNLLIATSVVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIK
S
FEEDLKTYKAIEK
ILRNKCSKSADGAEADVHAGVDDEDAFPPYVLRPDDGGPRVTINTAIGHINRYCAR
L
PSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIV
GPPMDSVRLAERVVALICCEKLHKIGELDE
H
LMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKA
IPECLRESYPKPDQPCYLYVIGMVLTTP
L
PDELNFRRRKLYPPEDTTRCFGILTAKPIPQ
IPHFPVYTRSGEVTISIELKKSGFTLSQQMLELITRLH
Q
YIFSHILRLEKPALEFKPTGAESAYCVLPLNV
VNDSGTLDIDFKFMEDIEKSEARIGIPSTKYSKETPF
V
FKLEDYQDAVIIP
RYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDV
D
HTSS
RLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYR
L
HCLLTAEELRAQTASDAGVGVRSLPVDF
RYPNLDFGWKKSIDSKSFISSCNSSLAESDNYCKHSTTVVP
E
HAAHQGATRPSLENHDQMSVNCKRLPAESPAKLQSEVSTDLTAINGLSYNKNLANGSYDLVNRDFCQGN
Q
LNYFKQEIPVQPTTSYPIQNLYNYENQPKPSNECPLLSNTYLDGNANTSTSDGSPAVSTMPAMMNAVKA
L
KDRMDSEQSPSVGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHE
G
RLSYMRSKK
VSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNSEKWEKDEMTKDCLLAN
G
KLGEACEEEEDLTWRAPKEEAEDEDDFLEYDQEHIQFIDSMLMGSGAFVRKISLSPFSASDSAYEWKMP
K
KASLGSMPFASGLEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCI
A
DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSREKALDPAQENGSSQQKSLSGSCASP
V
GPRSSAGKDLEYGCLKIPPRCMFDHPDAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNT
I
T
DCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELF
H
VIDDFVKFQLEKNEMQGMDSE
LRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYP
M
MQPLI
EKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAAR
R
ALRSLKANQPQVPNS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser