NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35898.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35898.1 Public Mus musculus 10 Gopc 16 104 75 CCDS HistoryNCBI Gene:94221Re-query CCDS DB by CCDS ID:35898.1Re-query CCDS DB by GeneID:94221

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 35898.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020008 ENSMUSP00000020008 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020008Link to Ensembl Protein Viewer:ENSMUSP00000020008Re-query CCDS DB by Nucleotide ID:ENSMUST00000020008Re-query CCDS DB by Protein ID:ENSMUSP00000020008
Original member Current member NCBI NM_053187.3 NP_444417.2 Accepted alive Link to Nucleotide Sequence:NM_053187.3Link to Protein Sequence:NP_444417.2Re-query CCDS DB by Nucleotide ID:NM_053187Re-query CCDS DB by Protein ID:NP_444417Link to BLink:NP_444417.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_444417.2 455 Q8BH60-2 455 100% 0 0

Chromosomal Locations for CCDS 35898.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

Chromosome Start Stop Links
10 52339723 52339853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52346049 52346229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52349072 52349236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52350601 52350696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52353327 52353492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52354572 52354747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52358773 52358937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 52381611 52381898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1368 nt):
ATGTCGGCGGGTGGCCCATGCCCGGCGGGAGCCGGCGGCGGCCCAGGGGGCTCCTCCTGCCCTGTGGGGG
TC
TCCCCTGGCGGGGTGTCCATGTTCCGATGGCTTGAGGTGCTGGAGAAGGAGTTCGACAAGGCCTTCGT
G
GATGTGGATCTGCTTTTGGGCGAGATCGATCCGGACCAGGCGGACATCACTTATGAGGGGCGTCAGAAG
ATG
ACCAGCCTTAGCTCCTGCTTTGCGCAGCTATGCCACAAAGCCCAGACTGTGTCCCAGATCAACCACA
AG
CTTGAGGCACAGTTGGTGGATCTGCGATCGGAATTGACAGAGACTCAAGCAGAGAAAGTTGTTCTGGA
G
AAAGAAGTCCACGAGCAGCTTTTACAGCTGCACTCCACTCAGCTTCAGCTTCATGCCAAGACTGGTCAA
AGT
GTTGACTCTGGGGCCATCAAGGCAAAATTGGAAAGAGAACTTGAAGCAAATAAAACAGAAAAGGTAA
AA
GAAGCTCGACTTGAAGCTGAAGTGAAGCTACTAAGGAAGGAGAACGAGGCTCTTCGAAGGCACATAGC
T
GTTCTCCAGGCTGAAGTTTATGGGGCGAGGTTGGCTGCCAAGTACTTGGATAAGGAGCTGGCCGGCAGG
GTG
CAACAGATACAATTACTGGGACGGGATATGAAGGGACCTGCTCACGATAAGCTCTGGAACCAGTTAG
AA
GCTGAAATACATTTGCATCGCCACAAAACTGTCATCAGAGCCTGCAGAGGGCGCAACGACTTGAAGCG
G
CCCATGCAAGCACCCCCAGGCCACGATCAAGACTCTTTGAAGAAAAGCCAGGGAGTCGGTCCAATTAGA
AAA
GTTCTCCTCCTTAAGGAAGACCATGAAGGCCTGGGCATTTCTATCACAGGTGGGAAAGAGCACGGTG
TT
CCCATCCTCATCTCTGAGATCCACCCGGGACAGCCTGCGGATAGATGTGGAGGGCTGCATGTTGGAGA
T
GCTATTCTGGCAGTCAATGGAGTCAACCTAAGAGACACAAAGCATAAAGAAGCTGTAACTATACTCTCC
CAG
CAGAGAGGAGAGATTGAGTTTGAAGTAGTCTACGTGGCACCTGAAGTGGATTCTGACGATGAAAATG
TA
GAGTATGAAGACGAGAGTGGACACCGCTATCGTCTGTATCTTGACGAGTTAGAAGGCAGTGGGAATTC
T
GGTGCTAGTTGCAAAGACAGCAGTGGCGAGATGAAAATGTTACAAGGGTATAACAAGAAGGCAGTGAGG
GAT
GCGCATGAGAATGGGGACGTGGGGGCTGCAGGTGAGAGCCCTCTGGATGACACTGCTGCGAGAGCGG
CT
CATCTGCACAGCCTGCATCAGAAGAAGGCCTACTAA


Translation (455 aa):
MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQK
M
TSLSSCFAQLCHKAQTVSQINHKLE
AQLVDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQ
S
VDSGAIKAKL
ERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGR
V
QQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGH
DQDSLKKSQGVGPIR
K
VLLLKEDHEGLGISIT
GGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILS
Q
Q
RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNSGASCKDSSGEMKMLQGYNKKAVR
D
AHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser