NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35867.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35867.1 Public Mus musculus 10 Eya4 16 104 75 CCDS HistoryNCBI Gene:14051Re-query CCDS DB by CCDS ID:35867.1Re-query CCDS DB by GeneID:14051

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 35867.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000092665 ENSMUSP00000090335 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000092665Link to Ensembl Protein Viewer:ENSMUSP00000090335Re-query CCDS DB by Nucleotide ID:ENSMUST00000092665Re-query CCDS DB by Protein ID:ENSMUSP00000090335
Original member Current member NCBI NM_010167.4 NP_034297.2 Accepted alive Link to Nucleotide Sequence:NM_010167.4Link to Protein Sequence:NP_034297.2Re-query CCDS DB by Nucleotide ID:NM_010167Re-query CCDS DB by Protein ID:NP_034297Link to BLink:NP_034297.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034297.2 616 Q9Z191 616 98.2143% 0 11

Chromosomal Locations for CCDS 35867.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

Chromosome Start Stop Links
10 23106208 23106288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23109832 23109932 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23111560 23111681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23113910 23114024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23116553 23116713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23116820 23116878 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23123852 23123941 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23138191 23138274 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23139961 23140097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23151932 23152097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23155920 23155999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23157252 23157395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23157512 23157654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23159088 23159154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23163394 23163486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23172999 23173123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23226802 23226851 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 23323048 23323080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1851 nt):
ATGGAAGACACCCAGGACCTAAATGAGCAATCTGTAAAGAAAACGTGCCCAGAAGCAGATGTTTCGGAAC
CT
CAGAATTCCAGGTCTATGGAAATGCAAGACCTAGCAAGTCCCCATGCCTTGGTTGGAGGCAGTGATAC
A
CCTGGGAGCTCCAAGCTGGATAAATCTGGTCTCAGCAGCACTTCAGTCACAACAAATGGGACAGGAGTG
TCT
CTTCTTGCAGTCAAAACAGAGCCCTTGCACAGCAGTGAGTCCACTACCACGACTGGAGATGGAGCGC
TT
GACACTTTTACTGGGTCAGTAATAACAAGCAGCGGCTACAGCCCCAGGTCGGCGCAGCAGTACTCTCC
A
CAGCTGTACCCCTCCAAGCCCTATCCACACATTCTTTCTACACCAGCAGCTCAAACAATGTCGGCCTAT
GCA
GGCCAGACTCAGTACTCTGGGATGCAGCAGCCGGCCGTCTACACAGCCTACTCGCAGACAGGACAGC
CC
TACAGCCTGCCTGCCTACGATCTTGGTGTGATGTTGCCAGCCATCAAGACGGAAAGTGGGCTTTCCCA
A
ACTCAGTCCCCGTTACAGAGTGGCTGCCTGAGCTACAGCCCTGGGTTTTCTACCCCACAGCCAGGCCAG
ACG
CCTTACTCTTACCAAATGCCAGGTTCCAGCTTTGCACCATCGTCTACTATTTATGCAAATAATTCCG
TT
TCTAATTCAACAAACTTCAGCAGCTCACAGCAGGATTACCCATCCTACACAGCCTTTGGCCAAAACCA
A
TATGCTCAGTATTACTCAGCATCAACCTATGGGGCATACATGACATCAAACAACACAGCTGACGGCACA
TCA
TCGTCAACATCAACTTATCAGCTGCAGGAATCTCTCCAAGGACTGACTAGCCAACCAGGAGAGTTTG
AT
ACAGTGCAGAGTCCCTCCACACCAATCAAAGATCTCGATGACAGAACATGTAGAAGTTCTGGGTCAAA
G
TCTCGAGGAAGAGGCCGGAAAAATAATCCCTCCCCACCTCCGGACAGTGACCTAGAGCGTGTGTTTGTC
TGG
GACTTGGATGAAACCATCATCGTCTTCCACTCTCTCCTCACGGGCTCTTATGCACAGAAGTATGGCA
AG
GATCCCCCAATGGCTGTGACTCTCGGGCTCCGGATGGAAGAAATGATCTTTAATCTTGCAGATACACA
T
TTGTTTTTTAATGACTTAGAGGAGTGTGATCAAGTTCATATAGATGATGTTTCCTCCGACGACAATGGT
CAG
GACTTAAGTACCTACAGTTTTGCAACTGATGGCTTCCATGCAGCTGCAAGTAGTGCGAACCTTTGTT
TG
CCAACAGGTGTGAGAGGAGGAGTGGACTGGATGAGGAAGCTGGCTTTTCGTTACAGAAGAGTAAAGGA
A
TTATATAACACCTACAAGAACAATGTTGGAGGACTCCTTGGCCCTGCTAAGAGGGATGCATGGCTGCAG
TTA
AGGGCAGAGATCGAAGGCCTAACAGATTCCTGGCTAACGAATGCACTTAAGTCTTTATCAATTATTA
GT
ACTAGGAGTAACTGTGTAAATGTCTTGGTAACGACAACCCAGCTGATTCCTGCTCTTGCAAAAGTCCT
G
CTCTACAGCCTAGGAGGTGCTTTCCCCATTGAGAACATTTACAGCGCAACGAAAATAGGAAAAGAAAGT
TGC
TTTGAGCGAATAATGCAAAGGTTTGGCAGAAAAGTAGTGTATGTTGTAATTGGGGATGGTGTAGAAG
AA
GAGCAGGCAGCAAAAAAGCACAACATGCCCTTTTGGAGGATATCAAGCCACTCGGACCTCTTGGCTCT
A
CATCAAGCACTGGAATTAGAGTATTTGTAA


Translation (616 aa):
MEDTQDLNEQSVKKTCPEADVSEPQNSRSMEMQDLASPHALVGGSDTPGSSKLDKSGLSSTSVTTNGTGV
S
LLAVKTEPLHSSESTTTTGDGALDTFTGS
VITSSGYSPRSAQQYSPQLYPSKPYPHILSTPAAQTMSAY
A
GQTQYSGMQQPAVYTAYSQTGQPYSLPAY
DLGVMLPAIKTESGLSQTQSPLQSGCLSYSPGFSTPQPGQ
T
PYSYQMP
GSSFAPSSTIYANNSVSNSTNFSSSQQDYPSYTAFGQNQYAQYYSASTYGAYMTSNNTADGT
S
SSTSTYQLQESLQGLTSQP
GEFDTVQSPSTPIKDLDDRTCRSSGSKSRGRGRKNNPSPPPDSDLERVFV
W
DLDETIIVFHSLLTGSYAQKYGK
DPPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNG
Q
DL
STYSFATDGFHAAASSANLCLPTGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLLGPAKRDAWLQ
L
RAEIEGLTDSWLTNALKSLSIIST
RSNCVNVLVTTTQLIPALAKVLLYSLGGAFPIENIYSATKIGKES
C
FERIMQRFGRKVVYVVIGDGVEEEQAAKK
HNMPFWRISSHSDLLALHQALELEYL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser