NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35856.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35856.1 Public Mus musculus 10 Ifngr1 16 104 75 CCDS HistoryNCBI Gene:15979Re-query CCDS DB by CCDS ID:35856.1Re-query CCDS DB by GeneID:15979

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 35856.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020188 ENSMUSP00000020188 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020188Link to Ensembl Protein Viewer:ENSMUSP00000020188Re-query CCDS DB by Nucleotide ID:ENSMUST00000020188Re-query CCDS DB by Protein ID:ENSMUSP00000020188
Original member Current member EBI,WTSI OTTMUST00000090213 OTTMUSP00000049447 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000090213Link to Vega Protein Viewer:OTTMUSP00000049447Re-query CCDS DB by Nucleotide ID:OTTMUST00000090213Re-query CCDS DB by Protein ID:OTTMUSP00000049447
Original member Current member NCBI NM_010511.2 NP_034641.1 Accepted alive Link to Nucleotide Sequence:NM_010511.2Link to Protein Sequence:NP_034641.1Re-query CCDS DB by Nucleotide ID:NM_010511Re-query CCDS DB by Protein ID:NP_034641Link to BLink:NP_034641.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034641.1 477 P15261 477 100% 0 0

Chromosomal Locations for CCDS 35856.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 19592086 19592197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 19597416 19597530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 19601320 19601483 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 19603754 19603932 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 19606234 19606420 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 19607257 19607381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 19609137 19609688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1434 nt):
ATGGGCCCGCAGGCGGCAGCTGGCAGGATGATTCTGCTGGTGGTCCTGATGCTGTCTGCGAAGGTCGGGA
GT
GGAGCTTTGACGAGCACTGAGGATCCTGAGCCTCCCTCGGTGCCTGTACCGACGAATGTTCTAATTAA
G
TCTTATAACTTGAACCCTGTCGTATGCTGGGAATACCAGAACATGTCACAGACTCCTATTTTTACTGTA
CAG
GTAAAGGTGTATTCGGGTTCCTGGACTGATTCCTGCACCAACATTTCTGATCATTGTTGTAATATCT
AT
GAACAAATTATGTATCCTGATGTATCTGCCTGGGCCAGAGTTAAAGCTAAGGTTGGACAAAAAGAATC
T
GACTATGCACGGTCAAAAGAGTTCCTTATGTGCCTAAAGGGAAAGGTCGGGCCCCCTGGCCTGGAGATC
AGG
AGGAAGAAGGAAGAACAGCTCTCCGTCCTCGTATTTCACCCTGAAGTCGTTGTGAATGGAGAGAGCC
AG
GGAACCATGTTTGGTGACGGGAGCACCTGTTACACATTCGACTATACTGTGTATGTGGAGCATAACCG
G
AGTGGGGAGATCCTACATACGAAACATACGGTCGAAAAAGAAGAGTGTAATGAGACTCTGTGTGAGTTA
AAC
ATCTCAGTATCCACACTGGATTCCAGATATTGTATTTCAGTAGACGGAATCTCATCTTTCTGGCAAG
TT
AGAACAGAAAAATCGAAAGACGTCTGTATCCCTCCTTTCCATGATGACAGAAAGGATTCAATTTGGAT
T
CTGGTGGTTGCTCCTCTTACCGTCTTTACAGTAGTTATCCTGGTATTTGCGTATTGGTATACTAAGAAG
AAT
TCATTCAAGAGAAAAAGCATAATGTTACCTAAGTCCTTGCTCTCTGTGGTAAAAAGTGCCACGTTAG
AG
ACAAAACCTGAATCGAAGTATTCACTTGTCACACCGCACCAGCCAGCTGTCCTAGAGAGTGAGACGGT
G
ATCTGTGAAGAGCCCCTGTCCACAGTGACAGCTCCAGACAGCCCCGAAGCAGCAGAACAGGAAGAACTT
TCA
AAAGAAACAAAGGCTCTGGAGGCTGGAGGAAGCACGTCTGCCATGACCCCAGACAGCCCTCCAACTC
CG
ACACAAAGACGCAGCTTTTCCCTGTTAAGTAGTAACCAGTCAGGCCCTTGTAGCCTCACCGCCTATCA
C
TCCCGAAACGGCTCTGACAGTGGCCTCGTGGGATCGGGCAGCTCCATATCGGACTTGGAATCTCTCCCA
AAC
AACAACTCAGAAACAAAGATGGCAGAGCACGACCCTCCACCCGTGAGAAAGGCCCCCATGGCCTCCG
GT
TATGACAAACCGCACATGTTGGTGGACGTGCTTGTGGATGTTGGGGGGAAGGAGTCTCTCATGGGGTA
T
AGACTCACAGGAGAGGCCCAGGAGCTGTCCTAA


Translation (477 aa):
MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTV
Q
VKVY
SGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEI
R
RKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGE
ILHTKHTVEKEECNETLCEL
N
ISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRK
DSIWILVVAPLTVFTVVILVFAYWYTKK
N
SFKRKSIMLPKSL
LSVVKSATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEEL
S
KETKALEAGGSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLP
N
NNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser