NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35841.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35841.1 Public Mus musculus 10 Utrn 16 104 75 CCDS HistoryNCBI Gene:22288Re-query CCDS DB by CCDS ID:35841.1Re-query CCDS DB by GeneID:22288See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 35841.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000076817 ENSMUSP00000076093 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000076817Link to Ensembl Protein Viewer:ENSMUSP00000076093Re-query CCDS DB by Nucleotide ID:ENSMUST00000076817Re-query CCDS DB by Protein ID:ENSMUSP00000076093
Original member Current member NCBI NM_011682.4 NP_035812.3 Accepted alive Link to Nucleotide Sequence:NM_011682.4Link to Protein Sequence:NP_035812.3Re-query CCDS DB by Nucleotide ID:NM_011682Re-query CCDS DB by Protein ID:NP_035812Link to BLink:NP_035812.3

Chromosomal Locations for CCDS 35841.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 12384188 12384196 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12385518 12385540 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12401311 12401403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12402883 12402991 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12405854 12406094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12406436 12406594 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12413936 12414001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12415181 12415246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12415451 12415489 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12421597 12421733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12436281 12436392 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12439627 12439793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12441936 12442093 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12448007 12448092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12455363 12455564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12463286 12463360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12465181 12465242 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12475271 12475331 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12478413 12478491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12481224 12481370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12486386 12486654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12501378 12501507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12525338 12525494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12538041 12538213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12621191 12621380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12633944 12634098 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12636596 12636801 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12640927 12641044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12643403 12643611 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12649143 12649218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12652711 12652860 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12654699 12654834 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12658496 12658671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12660779 12660929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12663366 12663538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12664947 12665138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12666699 12666836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12667500 12667658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12669656 12669826 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12670120 12670248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12671751 12671930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12678580 12678750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12680472 12680627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12682277 12682450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12683245 12683373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12684410 12684571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12686332 12686481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12688293 12688427 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12690730 12690909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12693364 12693534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12697989 12698144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12699002 12699115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12709966 12710178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12711438 12711583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12713254 12713434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12714133 12714374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12720018 12720105 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12720819 12720942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12726211 12726380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12727733 12727912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12728711 12728818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12733899 12734000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12735098 12735217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12736952 12737102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12738085 12738266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12739367 12739570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12744045 12744205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12745232 12745347 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12747915 12748087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12750031 12750123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12750465 12750542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12751495 12751587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12765271 12765332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 12861568 12861646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (10293 nt):
ATGGCCAAGTATGGGGACCTTGAAGCCAGGCCTGATGATGGGCAGAACGAATTCAGTGACATCATTAAGT
CC
AGATCTGATGAACACAATGATGTACAGAAGAAAACCTTTACCAAATGGATAAACGCTCGATTTTCCAA
G
AGTGGGAAACCACCCATCAGTGATATGTTCTCAGACCTCAAAGATGGGAGAAAGCTCTTGGATCTTCTC
GAA
GGCCTCACAGGAACATCATTGCCAAAGGAACGTGGTTCCACAAGGGTGCATGCCTTAAACAATGTCA
AC
CGAGTGCTACAGGTTTTACATCAGAACAATGTGGACTTGGTGAATATTGGAGGCACGGACATTGTGGA
T
GGAAATCCCAAGCTGACTTTAGGGTTACTCTGGAGCATCATTCTGCACTGGCAGGTGAAGGATGTCATG
AAA
GATATCATGTCAGACCTGCAGCAGACAAACAGCGAGAAGATCCTGCTGAGCTGGGTGCGGCAGACCA
CC
AGGCCCTACAGTCAAGTCAACGTCCTCAACTTCACCACCAGCTGGACCGATGGACTCGCGTTCAACGC
C
GTGCTCCACCGGCACAAACCAGATCTCTTCAGCTGGGACAGAGTGGTCAAAATGTCCCCAATTGAGAGA
CTT
GAACATGCTTTTAGCAAGGCCCACACTTATTTGGGAATTGAAAAGCTTCTAGATCCTGAAGATGTTG
CT
GTGCATCTCCCTGACAAGAAATCCATAATTATGTATTTAACGTCTCTGTTTGAGGTGCTTCCTCAGCA
A
GTCACGATAGATGCCATCCGAGAGGTGGAGACTCTCCCAAGGAAGTATAAGAAAGAATGTGAAGAGGAA
GAA
ATTCATATCCAGAGTGCAGTGCTGGCAGAGGAAGGCCAGAGTCCCCGAGCTGAGACCCCTAGCACCG
TC
ACTGAAGTGGACATGGATTTGGACAGCTACCAGATAGCGCTAGAGGAAGTGCTGACGTGGCTGCTGTC
C
GCGGAGGACACGTTCCAGGAGCAAGATGACATTTCTGATGATGTCGAAGAAGTCAAAGAGCAGTTTGCT
ACC
CATGAAACTTTTATGATGGAGCTGACAGCACACCAGAGCAGCGTGGGGAGCGTCCTGCAGGCTGGCA
AC
CAGCTGATGACACAAGGGACTCTGTCAGAGGAGGAGGAGTTTGAGATCCAGGAACAGATGACCTTGCT
G
AATGCAAGGTGGGAGGCGCTCCGGGTGGAGAGCATGGAGAGGCAGTCCCGGCTGCACGACGCTCTGATG
GAG
CTGCAGAAGAAACAGCTGCAGCAGCTCTCAAGCTGGCTGGCCCTCACAGAAGAGCGCATTCAGAAGA
TG
GAGAGCCTCCCGCTGGGTGATGACCTGCCCTCCCTGCAGAAGCTGCTTCAAGAACATAAAAGTTTGCA
A
AATGACCTTGAAGCTGAACAGGTGAAGGTAAATTCCTTAACTCACATGGTGGTGATTGTGGATGAAAAC
AGT
GGGGAGAGTGCCACAGCTCTTCTGGAAGATCAGTTACAGAAACTGGGTGAGCGCTGGACAGCTGTAT
GC
CGCTGGACTGAAGAACGTTGGAACAGGTTGCAAGAAATCAGTATTCTGTGGCAGGAATTATTGGAAGA
G
CAGTGTCTGTTGGAGGCTTGGCTCACCGAAAAGGAAGAGGCTTTGAATAAAGTTCAAACCAGCAACTTT
AAA
GACCAGAAGGAACTAAGTGTCAGTGTCCGGCGTCTGGCTATATTGAAGGAAGACATGGAAATGAAGA
GG
CAGACTCTGGATCAACTGAGTGAGATTGGCCAGGATGTGGGCCAATTACTCAGTAATCCCAAGGCATC
T
AAGAAGATGAACAGTGACTCTGAGGAGCTAACACAGAGATGGGATTCTCTGGTTCAGAGACTCGAAGAC
TCT
TCTAACCAGGTGACTCAGGCGGTAGCGAAGCTCGGCATGTCCCAGATTCCACAGAAGGACCTATTGG
AG
ACCGTTCATGTGAGAGAACAAGGGATGGTGAAGAAGCCCAAGCAGGAACTGCCTCCTCCTCCCCCACC
A
AAGAAGAGACAGATTCACGTGGACGTGGAGGCCAAGAAAAAGTTTGATGCTATAAGTACAGAGCTGCTG
AAC
TGGATTTTGAAATCAAAGACTGCCATTCAGAACACAGAGATGAAAGAATATAAGAAGTCGCAGGAGA
CC
TCAGGAATGAAAAAGAAATTGAAGGGATTAGAGAAAGAACAGAAGGAAAATCTGCCCCGACTGGACGA
A
CTGAATCAAACCGGACAAACCCTCCGGGAGCAAATGGGAAAAGAAGGCCTTTCCACTGAAGAAGTAAAC
GAT
GTTCTGGAAAGGGTTTCGTTGGAGTGGAAGATGATATCTCAGCAGCTAGAAGATCTGGGAAGGAAGA
TC
CAGCTGCAGGAAGATATAAATGCTTATTTTAAGCAGCTTGATGCCATTGAGGAGACCATCAAGGAGAA
G
GAAGAGTGGCTGAGGGGCACACCCATTTCTGAATCGCCCCGGCAGCCCTTGCCAGGCTTAAAGGATTCT
TGC
CAGAGGGAACTGACAGATCTCCTTGGCCTTCACCCCAGAATTGAGACGCTGTGTGCAAGCTGTTCAG
CC
CTGAAGTCTCAGCCCTGTGTCCCAGGTTTTGTCCAGCAGGGTTTTGACGACCTTCGACATCATTACCA
G
GCTGTGCGGAAGGCTTTAGAGGAATACCAACAACAACTAGAAAATGAGCTGAAGAGCCAGCCTGGACCC
GCG
TATTTGGACACACTGAATACCCTGAAAAAAATGCTAAGCGAGTCAGAAAAGGCGGCCCAGGCCTCTC
TG
AATGCCCTGAACGATCCCATAGCGGTGGAGCAGGCCCTGCAGGAGAAAAAGGCCCTTGATGAAACCCT
T
GAGAATCAGAAACATACGTTACATAAGCTTTCAGAAGAAACGAAGACTTTGGAGAAAAATATGCTTCCT
GAT
GTGGGGAAAATGTATAAACAAGAATTTGATGATGTCCAAGGCAGATGGAATAAAGTAAAGACCAAGG
TT
TCCAGAGACTTACACTTGCTCGAGGAAATCACCCCCAGACTCCGAGATTTTGAGGCTGATTCAGAAGT
C
ATTGAGAAGTGGGTGAGTGGCATCAAAGACTTCCTCATGAAAGAACAGGCTGCTCAAGGAGACGCTGCT
GCG
CTGCAGAGCCAGCTTGACCAATGTGCTACGTTTGCTAATGAAATCGAAACCATCGAGTCATCTCTGA
AG
AACATGAGGGAAGTAGAGACTAGCCTTCAGAGGTGTCCAGTCACTGGAGTCAAGACATGGGTACAGGC
A
AGACTAGTGGATTACCAATCCCAACTGGAGAAATTCAGCAAAGAGATTGCTATTCAAAAAAGCAGGCTG
TCA
GATAGTCAAGAAAAAGCCCTGAACTTGAAAAAGGATTTGGCTGAGATGCAGGAGTGGATGGCACAGG
CT
GAAGAGGACTACCTGGAGAGGGACTTCGAGTACAAATCTCCAGAAGAACTCGAGAGTGCGGTGGAGGA
A
ATGAAGAGGGCAAAAGAGGAGGTGCTGCAGAAGGAGGTGAGGGTGAAAATTCTGAAGGACAGCATCAAG
CTG
GTGGCTGCCAAGGTGCCCTCTGGTGGCCAGGAGTTGACGTCGGAATTCAACGAGGTGCTGGAGAGCT
AC
CAGCTTCTGTGCAATAGAATTCGAGGGAAGTGCCACACACTGGAGGAGGTCTGGTCTTGCTGGGTGGA
G
CTGCTTCACTATCTGGACCTGGAGACCACGTGGTTGAACACCTTGGAGGAGCGCGTGAGGAGCACGGAG
GCC
CTGCCTGAGAGGGCAGAAGCTGTTCATGAAGCTCTGGAGTCTCTTGAGTCTGTTTTGCGCCATCCGG
CG
GATAATCGCACCCAGATTCGGGAACTTGGGCAGACTCTGATTGATGGTGGAATCCTGGATGACATAAT
C
AGCGAGAAGCTGGAGGCTTTTAACAGCCGCTACGAAGAGCTGAGTCACTTGGCGGAGAGCAAACAGATT
TCT
TTGGAGAAGCAACTCCAGGTCCTCCGCGAAACTGACCACATGCTTCAGGTGCTGAAGGAGAGCCTGG
GG
GAGCTGGACAAACAGCTTACCACATACCTGACGGACAGGATCGATGCCTTCCAACTGCCACAGGAAGC
T
CAGAAGATCCAAGCCGAAATCTCAGCCCATGAGCTCACCCTGGAGGAGCTGAGGAAGAATGTGCGCTCC
CAG
CCCCCGACGTCCCCTGAGGGCAGGGCCACCAGAGGAGGAAGTCAGATGGACATGCTACAGAGGAAAC
TT
CGAGAGGTCTCCACCAAATTCCAGCTTTTCCAGAAGCCCGCAAATTTCGAGCAGCGGATGCTGGACTG
C
AAGCGTGTGTTGGAGGGAGTGAAGGCCGAGCTTCATGTCCTCGATGTGAGGGATGTGGACCCTGACGTC
ATT
CAGGCCCACTTGGACAAGTGCATGAAACTATATAAAACGTTGAGTGAAGTCAAACTTGAAGTTGAGA
CT
GTCATCAAAACAGGGAGGCACATTGTCCAGAAGCAGCAGACGGACAACCCGAAAAGCATGGACGAACA
G
CTTACATCTCTGAAAGTCCTCTACAATGACCTGGGCGCACAGGTGACAGAAGGGAAGCAAGACCTGGAA
AGA
GCCTCACAGCTGTCCAGGAAGATGAAGAAGGAGGCTGCCGTCCTCTCTGAATGGCTCTCTGCCACAG
AG
GCAGAACTAGTGCAGAAATCCACATCAGAAGGCGTGATTGGTGACCTGGACACAGAAATCTCCTGGGC
T
AAAAGTATTCTCAAGGATCTGGAAAAGAGGAAAGTTGACTTAAATGGCATTACAGAGAGCAGTGCCGCC
CTT
CAGCACTTGGTCTTGGGCAGTGAGTCTGTTCTGGAAGAGAACCTCTGTGTGCTCAATGCTGGATGGA
GC
CGAGTGCGGACGTGGACCGAAGACTGGTGCAACACCTTGCTGAACCATCAAAACCAGCTGGAGCTATT
T
GATGGACACGTCGCTCACATCAGTACCTGGCTCTATCAAGCCGAAGCTCTGCTGGATGAGATCGAAAAG
AAA
CCAGCGAGTAAACAGGAAGAAATTGTGAAGCGTTTACTGTCTGAATTGGATGATGCCAGCCTCCAGG
TT
GAGAATGTTCGGGAACAAGCCATCATCTTGGTGAATGCTCGTGGAAGCGCCAGCAGGGAACTCGTGGA
A
CCAAAATTAGCCGAGCTGAGCAGGAACTTTGAAAAGGTGTCCCAGCACATAAAGAGCGCCCGAATGCTG
ATT
GGTCAGGACCCTTCATCCTACCAAGGCTTGGACCCTGCTGGAACTGTTCAAGCTGCTGAGTCTTTCT
CT
GACTTGGAAAACTTAGAACAAGACATAGAAAACATGTTGAAAGTTGTGGAAAAGCACTTGGACCCCAA
T
AACGATGAGAAGATGGATGAGGAGCAAGCCCAGATTGAGGAAGTTCTACAAAGAGGGGAGCATTTGTTA
CAT
GAACCTATGGAGGACAGTAAGAAAGAAAAGATCCGCTTGCAGTTGTTACTTTTGCATACTCGTTACA
AC
AAAATTAAGACAATCCCTATCCAGCAGAGAAAAACAATTCCAGTTTCTTCTGGAATTACATCATCAGC
C
CTCCCTGCAGATTATTTGGTTGAAATTAATAAAATTTTACTCACTCTGGATGACATTGAATTATCACTT
AAT
ATGCCGGAGCTAAACACCACTGTCTACAAAGACTTCTCTTTCCAGGAAGACTCTCTGAAGAGTATCA
AA
GGTCAACTGGACAGACTTGGAGAGCAGATTGCAGTTGTTCACGAGAAGCAGCCGGATGTCATCGTGGA
A
GCCTCTGGCCCTGAGGCCATTCAGATCAGGGACATGCTCGCTCAGCTGAATGCAAAATGGGACCGAGTG
AAT
AGAGTGTACAGTGATCGGAGAGGGTCCTTTGCCAGGGCTGTGGAGGAATGGAGGCAGTTCCACCATG
AC
CTTGATGACCTTACACAGTGGCTATCTGAAGCTGAAGACCTGCTGGTAGACACTTGTGCTCCAGATGG
T
AGCCTGGACCTGGAGAAAGCCAGGGCACAGCAGCTGGAACTGGAAGAGGGCCTCAGCAGCCACCAGCCC
AGC
CTGATCAAGGTTAACCGAAAGGGGGAGGACCTTGTTCAGAGACTCCGCCCCTCGGAGGCAAGCTTCC
TG
AAGGAGAAGCTGGCAGGTTTCAACCAGCGCTGGAGCACTCTTGTAGCTGAGGTGGAGGCTTTGCAGCC
C
AGGCTAAAAGGAGAAAGTCAGCAGGTGTTGGGGTATAAGAGACGGCTAGATGAGGTCACCTGCTGGTTA
ACG
AAAGTGGAGAGTGCTGTGCAGAAGAGATCAACCCCTGACCCGGAAGAAAGCCCACAGGAATTAACAG
AT
TTAGCCCAAGAGACGGAAGTTCAAGCTGAAAACATTAAGTGGCTGAACAGAGCAGAACTGGAAATGCT
T
TCAGACAAAAATCTGAGTTTGCGTGAAAGAGAGAAACTTTCGGAAAGTTTAAGGAATGTAAACACAACA
TGG
ACCAAGGTATGCAGAGAAGTGCCTAGCCTCCTGAAGACACGCACCCAAGACCCCTGCTCTGCCCCAC
AG
ATGAGGATGGCTGCTCATCCCAACGTCCAAAAGGTGGTGCTAGTATCATCTGCATCAGATGCTCCTCT
G
CGTGGCGGCCTGGAAATCTCGGTTCCTGCTGATTTGGATAAAACCATCACAGAACTGGCTGACTGGCTG
GTA
TTGATCGACCAAATGCTGAAGTCCAACATTGTCACTGTGGGGGACGTGAAAGAGATCAATAAGACAG
TT
TCCCGGATGAAAATCACAAAGGCTGATTTAGAACAACGCCATCCTCAGCTTGATTGTGTATTTACCTT
G
GCCCAAAATTTGAAAAACAAAGCTTCCAGTTCAGATGTGAGGACAGCAATCACAGAAAAATTGGAAAAG
CTG
AAGACCCAGTGGGAGAGTACTCAGCATGGTGTGGAGCTGCGGCGGCAGCAGCTGGAGGACATGGTTG
TG
GACAGCCTGCAGTGGGACGACCACAGGGAAGAGACTGAAGAGCTCATGAGAAAATACGAGGCTCGCTT
C
TACATGCTGCAGCAGGCCCGCCGGGACCCACTTAGCAAACAAGTTTCTGATAATCAACTATTGCTTCAA
GAG
CTGGGGTCTGGCGATGGTGTCATCATGGCGTTTGATAATGTCCTGCAGAAACTTCTGGAAGAATACA
GT
GGCGATGACACAAGGAATGTGGAAGAAACCACGGAGTACTTGAAAACATCATGGGTCAATCTCAAACA
A
AGCATCGCTGATAGACAGAGTGCCTTGGAGGCTGAGCTACAGACAGTGCAGACTTCTCGTAGAGACCTG
GAG
AACTTTGTCAAGTGGCTTCAGGAAGCAGAAACCACAGCAAATGTGCTGGCCGATGCCTCTCAGCGGG
AG
AATGCTCTTCAGGACAGTGTCCTGGCCCGGCAGCTCCGACAGCAGATGCTGGACATCCAGGCAGAAAT
T
GATGCCCACAATGACATATTTAAAAGCATCGATGGAAACCGGCAGAAGATGGTGAAAGCTCTGGGGAAT
TCT
GAGGAAGCAACAATGCTTCAGCATCGACTGGATGACATGAACCAAAGATGGAATGATTTGAAGGCAA
AA
TCTGCTAGCATCAGGGCCCATTTGGAGGCCAGTGCTGAGAAATGGAACCGGTTGCTGGCATCGCTGGA
A
GAGCTGATCAAATGGCTCAATATGAAAGATGAGGAGCTTAAGAAGCAGATGCCCATTGGAGGGGACGTC
CCT
GCCTTACAGCTCCAGTATGACCACTGCAAGGTGCTGAGACGTGAGCTAAAGGAGAAAGAGTATTCTG
TG
CTGAACGCCGTAGATCAAGCTCGAGTTTTTCTGGCTGATCAGCCAATAGAGGCCCCCGAAGAACCAAG
A
AGAAACCCACAATCAAAGACAGAGTTGACTCCTGAGGAGAGAGCCCAGAAGATCGCCAAAGCCATGCGC
AAG
CAGTCTTCTGAAGTCCGAGAGAAGTGGGAAAATCTAAATGCTGTCACTAGCAACTGGCAAAAGCAAG
TA
GGGAAGGCGTTAGAGAAACTCCGAGACCTGCAGGGAGCTATGGACGACCTGGACGCAGACATGAAGGA
G
GTGGAGGCTGTGCGGAATGGCTGGAAGCCCGTGGGAGACCTGCTTATAGACTCCCTGCAGGATCACATC
GAG
AAAACCCTGGCGTTTAGAGAAGAAATTGCACCAATCAACTTAAAAGTAAAAACAATGAATGACCTGT
CC
AGTCAGCTGTCTCCACTTGACTTGCATCCATCTCTAAAGATGTCTCGCCAGCTGGATGACCTTAATAT
G
CGATGGAAACTTCTACAGGTTTCCGTGGACGATCGCCTTAAGCAGCTCCAGGAAGCCCACAGAGATTTT
GGG
CCATCTTCTCAACACTTTCTGTCCACTTCAGTCCAGCTGCCGTGGCAGAGATCCATTTCACATAATA
AA
GTGCCCTATTACATCAACCATCAAACACAGACAACCTGTTGGGATCATCCTAAAATGACTGAGCTCTT
C
CAATCCCTTGCTGATCTGAATAATGTACGTTTCTCTGCCTACCGCACAGCAATCAAAATTCGAAGGCTG
CAA
AAAGCATTATGTCTGGATCTCTTAGAGCTGAATACGACGAATGAAGTTTTCAAGCAGCACAAACTGA
AC
CAAAATGATCAGCTCCTGAGTGTCCCAGACGTCATCAACTGTCTGACCACCACTTACGATGGGCTTGA
G
CAGCTGCACAAGGACTTGGTCAATGTTCCACTCTGCGTCGATATGTGTCTCAACTGGCTGCTCAACGTA
TAC
GACACGGGCCGGACTGGAAAAATTCGGGTACAGAGTCTGAAGATTGGATTGATGTCTCTCTCCAAAG
GC
CTCTTAGAAGAGAAATACAGATGTCTCTTTAAGGAGGTGGCAGGGCCAACAGAGATGTGTGACCAGCG
G
CAGCTTGGCCTGCTACTTCACGATGCCATCCAGATCCCTAGGCAGCTGGGGGAAGTAGCAGCCTTTGGG
GGC
AGTAACATTGAGCCCAGTGTCCGCAGCTGCTTCCAGCAGAATAACAACAAGCCAGAAATCAGTGTGA
AG
GAGTTTATAGACTGGATGCATTTGGAACCCCAGTCCATGGTGTGGTTGCCGGTTCTGCATCGGGTCGC
A
GCTGCTGAGACTGCAAAACATCAGGCCAAATGCAACATCTGCAAAGAATGCCCGATTGTTGGGTTCAGA
TAC
AGGAGCCTAAAGCATTTTAATTATGATGTCTGCCAGAGTTGCTTCTTTTCTGGAAGAACAGCAAAGG
GC
CACAAGTTACATTACCCGATGGTAGAATACTGCATACCGACAACATCTGGGGAAGATGTGAGAGATTT
C
ACTAAGGTGCTGAAGAACAAGTTCAGGTCCAAGAAATATTTTGCCAAACATCCTCGGCTTGGCTACCTG
CCT
GTCCAGACCGTGCTGGAAGGGGACAACTTAGAAACTCCTATCACGCTCATCAGTATGTGGCCAGAGC
AC
TATGACCCCTCCCAGTCCCCTCAGCTGTTTCATGATGACACCCACTCAAGAATAGAGCAATACGCTAC
A
CGACTGGCCCAGATGGAAAGGACAAACGGGTCCTTCCTAACTGATAGCAGCTCTACAACAGGAAGCGTG
GAG
GATGAGCATGCCCTCATCCAGCAGTACTGCCAGACCCTGGGCGGGGAGTCACCTGTGAGTCAGCCGC
AG
AGTCCAGCTCAGATCCTGAAGTCCGTGGAGAGGGAAGAGCGTGGGGAACTGGAGCGGATCATTGCTGA
C
TTGGAGGAAGAGCAAAGAAATCTGCAGGTGGAGTATGAGCAGCTGAAGGAGCAGCACCTAAGAAGGGGT
CTC
CCTGTGGGCTCCCCTCCAGACTCCATCGTATCTCCTCACCACACATCTGAGGACTCAGAACTTATAG
CA
GAAGCTAAACTCCTGCGGCAGCACAAAGGGCGGCTGGAGGCGAGGATGCAAATTTTGGAAGATCACAA
T
AAACAGCTGGAGTCTCAGCTGCACCGCCTCAGACAGCTCCTGGAGCAGCCTGACTCTGACTCCCGCATC
AAT
GGTGTCTCCCCCTGGGCTTCCCCACAGCATTCTGCATTGAGCTACTCACTTGACACTGACCCAGGCC
CA
CAGTTCCACCAGGCAGCATCTGAGGACCTGCTGGCCCCACCTCACGACACTAGCACGGACCTCACGGA
C
GTGATGGAGCAGATCAACAGCACGTTTCCCTCTTGCAGCTCAAATGTCCCCAGCAGGCCACAGGCAATG
TGA


Translation (3430 aa):
MAKYGDLEARPDDGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPISDMFSDLKDGRKLLDLL
E
GLTGTSL
PKERGSTRVHALNNVNRVLQVLHQNNVDLVNIGGTDIVDGNPKLTLGLLWSIILHWQVKDVM
K
DIMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRH
KPDLFSWDRVVKMSPIER
L
EHAFSKAHTYLGIEKLLDPE
DVAVHLPDKKSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEE
E
IHIQ
SAVLAEEGQSPRAETPSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKEQFA
T
HE
TFMMELTAHQSSVGSVLQAGNQLMTQGTLSEEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALM
E
LQKKQLQQLSSWLALTEERIQKMESLPLGDDLPSLQKLLQEHK
SLQNDLEAEQVKVNSLTHMVVIVDEN
S
GESATALLEDQLQ
KLGERWTAVCRWTEERWNRLQEISILWQELLEEQCLLEAWLTEKEEALNKVQTSNF
K
DQKELSVSVRRLA
ILKEDMEMKRQTLDQLSEIGQDVGQLLSNPKASKKMNSDSEELTQRWDSLVQRLED
S
SNQ
VTQAVAKLGMSQIPQKDLLETVHVREQGMVKKPKQELPPPPPPKKRQIHVDVEAKKKFDAISTELL
N
WILKSKTAIQNTEMKEYKKSQETSGMKKKLK
GLEKEQKENLPRLDELNQTGQTLREQMGKEGLSTEEVN
D
VLERVSLEWKMISQQLEDLGRKIQLQEDINAYFKQLDAIEETIKEKEEWLRGTPISESPRQPLPGLKDS
C
Q
RELTDLLGLHPRIETLCASCSALKSQPCVPGFVQQGFDDLRHHYQAVRKALEEYQQQLENELKSQPGP
A
YLDTLNTLKKMLSESEKAAQASLNALNDPIAVEQALQEKK
ALDETLENQKHTLHKLSEETKTLEKNMLP
D
VGKMYKQEFDDVQGRWNKVKTKVSRDLHLLEEITPRLRDFE
ADSEVIEKWVSGIKDFLMKEQAAQGDAA
A
LQSQLDQCA
TFANEIETIESSLKNMREVETSLQRCPVTGVKTWVQARLVDYQSQLEKFSKEIAIQKSRL
S
DSQEKALNLKKDLAEMQEWMAQAEEDYLERDFEYKSPEELESAVEEMK
RAKEEVLQKEVRVKILKDSIK
L
VAAKVPSGGQELTSEFNEVLESYQLLCNRIRGKCHTLE
EVWSCWVELLHYLDLETTWLNTLEERVRSTE
A
LPERAEAVHEALE
SLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEELSHLAESKQI
S
LEKQLQVLRETDHMLQVLKESLGELDKQLTTYLTDRIDAFQLPQEAQ
KIQAEISAHELTLEELRKNVRS
Q
PPTSPEGRATRGGSQMDMLQ
RKLREVSTKFQLFQKPANFEQRMLDCKRVLEGVKAELHVLDVRDVDPDV
I
QAHLDKCM
KLYKTLSEVKLEVETVIKTGRHIVQKQQTDNPKSMDEQLTSLKVLYNDLGAQVTEGKQDLE
R
ASQLSRKMKKEAAVLSEWLSATEAELVQKSTSEGVIGDLDTEISWAK
SILKDLEKRKVDLNGITESSAA
L
QHLVLGSESVLEENLCVLNAGWSRVRTWTEDWCNTLL
NHQNQLELFDGHVAHISTWLYQAEALLDEIEK
K
PASKQEEIVK
RLLSELDDASLQVENVREQAIILVNARGSASRELVEPKLAELSRNFEKVSQHIKSARML
I
GQDPSSYQGLDPAGTVQAAESFSDLENLEQDIENMLKVVEKHLDPNNDEK
MDEEQAQIEEVLQRGEHLL
H
EPMEDSKKEKIRLQLLLLHTRYNKIK
TIPIQQRKTIPVSSGITSSALPADYLVEINKILLTLDDIELSL
N
MPELNTTVYKDFSFQEDSLK
SIKGQLDRLGEQIAVVHEKQPDVIVEASGPEAIQIRDMLAQLNAKWDRV
N
RVYSDRR
GSFARAVEEWRQFHHDLDDLTQWLSEAEDLLVDTCAPDGSLDLEKARAQQLELEEGLSSHQP
S
LIKVNRKGEDLVQRLRPSEASFLKEKLAGFNQRWSTLVAEVEALQP
RLKGESQQVLGYKRRLDEVTCWL
T
KVESAVQKRSTPDPEESPQELT
DLAQETEVQAENIKWLNRAELEMLSDKNLSLREREKLSESLRNVNTT
W
TK
VCREVPSLLKTRTQDPCSAPQMRMAAHPNVQKVVLVSSASDAPLRGGLEISVPADLDKTITELADWL
V
LIDQMLKSNIVTVGDVKEINKTVSRMK
ITKADLEQRHPQLDCVFTLAQNLKNKASSSDVRTAITEKLEK
L
KTQWESTQHGVELRRQQLEDMVVDSLQWDDHREETEELMRKYEARFYMLQQARRDPLSKQVSDNQ
LLLQ
E
LGSGDGVIMAFDNVLQKLLEEYSGDDTRNVEETTEYLKTSWVNLKQ
SIADRQSALEAELQTVQTSRRDL
E
NFVKWLQEAETTANVLADASQRENALQDSVLARQLRQQML
DIQAEIDAHNDIFKSIDGNRQKMVKALGN
S
EEATMLQHRLDDMNQRWNDLKAKSASI
RAHLEASAEKWNRLLASLEELIKWLNMKDEELKKQMPIGGDV
P
ALQLQYDHCK
VLRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRRNPQSKTELTPEERAQKIAKAMR
K
QSSEVREKWENLNAVTSNWQKQVGKALEKLRDLQGAMDDLDADMKEVEAVRNGWKPVGDLLIDSLQDHI
E
KTL
AFREEIAPINLKVKTMNDLSSQLSPLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDF
G
PSSQHFLS
TSVQLPWQRSISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRL
Q
KALC
LDLLELNTTNEVFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQLHKDLVNVPLCVDMCLNWLLNV
Y
D
TGRTGKIRVQSLKIGLMSLSKGLLEEKYRCLFKEVAGPTEMCDQRQLGLLLHDAIQIPRQLGEVAAFG
G
SNIEPSVRSCFQQ
NNNKPEISVKEFIDWMHLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIVGFR
Y
RSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIP
TTSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYL
P
VQTVLEGDNLE
TPITLISMWPEHYDPSQSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSV
E
DEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQ
RNLQVEYEQLKEQHLRRG
L
PVGSPPDSIVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ
PDSDSRI
N
GVSPWASPQHSALSYSLDTDPGPQFHQA
ASEDLLAPPHDTSTDLTDVMEQINSTFPSCSSNVPSRPQAM



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser