NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30289.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30289.1 Public Mus musculus X Heph 16 104 75 CCDS HistoryNCBI Gene:15203Re-query CCDS DB by CCDS ID:30289.1Re-query CCDS DB by GeneID:15203

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 30289.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033553 ENSMUSP00000033553 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033553Link to Ensembl Protein Viewer:ENSMUSP00000033553Re-query CCDS DB by Nucleotide ID:ENSMUST00000033553Re-query CCDS DB by Protein ID:ENSMUSP00000033553
Original member Current member EBI,WTSI ENSMUST00000113838 ENSMUSP00000109469 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113838Link to Ensembl Protein Viewer:ENSMUSP00000109469Re-query CCDS DB by Nucleotide ID:ENSMUST00000113838Re-query CCDS DB by Protein ID:ENSMUSP00000109469
Original member Current member EBI,WTSI OTTMUST00000044663 OTTMUSP00000020087 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044663Link to Vega Protein Viewer:OTTMUSP00000020087Re-query CCDS DB by Nucleotide ID:OTTMUST00000044663Re-query CCDS DB by Protein ID:OTTMUSP00000020087
Original member Current member EBI,WTSI OTTMUST00000044664 OTTMUSP00000020088 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044664Link to Vega Protein Viewer:OTTMUSP00000020088Re-query CCDS DB by Nucleotide ID:OTTMUST00000044664Re-query CCDS DB by Protein ID:OTTMUSP00000020088
Original member Current member NCBI NM_001159627.1 NP_001153099.1 Accepted alive Link to Nucleotide Sequence:NM_001159627.1Link to Protein Sequence:NP_001153099.1Re-query CCDS DB by Nucleotide ID:NM_001159627Re-query CCDS DB by Protein ID:NP_001153099Link to BLink:NP_001153099.1
Original member Current member NCBI NM_010417.2 NP_034547.2 Accepted alive Link to Nucleotide Sequence:NM_010417.2Link to Protein Sequence:NP_034547.2Re-query CCDS DB by Nucleotide ID:NM_010417Re-query CCDS DB by Protein ID:NP_034547Link to BLink:NP_034547.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153099.1 1157 Q9Z0Z4-1 1157 100% 0 0
NP_034547.2 1157 Q9Z0Z4-1 1157 100% 0 0

Chromosomal Locations for CCDS 30289.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 96462925 96463091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96465810 96466054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96469945 96470157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96470733 96470915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96472812 96473066 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96475378 96475546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96484031 96484167 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96486227 96486358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96497848 96498056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96498987 96499137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96500507 96500719 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96527510 96527723 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96529401 96529540 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96530294 96530425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96553843 96553949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96554835 96555060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96557510 96557649 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96558039 96558201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96570980 96571024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 96573568 96573800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3474 nt):
ATGAAGGCAGGCCATCTTCTCTGGGCTTTACTGTTGATGCACTCCTTGTGGTCTATACCAACTGATGGGG
CC
ATTCGAAACTACTACTTGGGCATCCAGGATATGCAGTGGAACTATGCTCCCAAAGGAAGAAATGTCAT
C
ACAAATCAGACTCTCAACAATGACACAGTGGCTTCCAGTTTCCTGAAGTCTGGCAAAAACAGGATAGGG
AGT
AGTTACAAGAAGACTGTTTATAAGGAATACAGTGATGGCACATACACTGAAGAAATAGCCAAGCCTG
CC
TGGTTGGGCTTCCTAGGACCACTGTTACAGGCTGAGGTGGGGGATGTCATCTTGATTCACCTGAAGAA
T
TTTGCGAGCCGACCTTACACCATTCACCCTCACGGTGTTTTTTATGAGAAGGACTCAGAAGGCTCACTA
TAC
CCAGATGGTTCTTCTGGGTATCTGAAAGCGGATGATTCTGTCCCCCCTGGGGGCAGCCATGTCTACA
AC
TGGAGTATTCCAGAAAGTCATGCCCCCACTGAGGCAGACCCAGCATGCCTCACCTGGATTTACCACTC
G
CATGTAGATGCTCCAAGAGACATTGCAACTGGTCTCATTGGACCTCTTATCACCTGTAAAAGAGGGACC
CTG
GATGGTAATTCCCCACCTCAGAGGAAGGATGTGGACCATAATTTCTTCCTCCTCTTCAGTGTGATAG
AT
GAGAACCTTAGCTGGCACCTTGATGACAACATTGCTACTTACTGCTCAGACCCTGCCTCGGTGGACAA
A
GAAGATGGAGCCTTTCAAGACAGCAACAGGATGCATGCAATCAATGGGTTTGTCTTTGGGAACTTACCA
GAG
TTGAGCATGTGTGCACAGAAGCATGTGGCCTGGCACTTGTTTGGCATGGGCAATGAAATAGATGTCC
AC
ACAGCTTTCTTCCATGGACAGATGCTGAGTATCCGTGGACACCACACTGATGTTGCAAACATTTTTCC
A
GCTACCTTTGTGACTGCTGAGATGGTGCCCCAAAAGTCTGGAACCTGGCTAATTAGCTGTGAAGTGAAC
AGC
CACTTGAGAAGTGGCATGCAGGCCTTCTACAAGGTTGACTCTTGCTCCATGGACCCACCTGTGGACC
AG
CTCACTGGCAAAGTTCGTCAGTACTTCATTCAGGCCCATGAGATTCAATGGGACTATGGTCCAATAGG
G
TATGATGGCAGAACTGGGAAGAGTTTGAGAGAGCCAGGAAGTGGCCCAGATAAGTACTTCCAGAAGAGC
TCT
AGTCGAATTGGAGGTACTTACTGGAAAGTTCGATATGAAGCCTTTCAAGATGAGACATTCCAGGAAA
GG
GTACATCAGGAAGAAGAAACACATCTTGGAATACTGGGACCAGTGATAAGGGCTGAAGTGGGTGACAC
C
ATCCAGGTGGTCTTCTATAACCGTGCCTCCCAGCCATTCAGCATACAGCCCCATGGTGTCTTTTATGAG
AAA
AACTCTGAGGGCACCGTGTACAATGATGGCACATCTCATCCCAAAGTAGCCAAGTCATTTGAAAAAG
TC
ACATACTACTGGACGGTTCCTCCCCATGCTGGGCCCACTGCTCAGGATCCTGCCTGTCTAACCTGGAT
G
TACTTCTCTGCTGCAGATCCCACAAGAGATACAAATTCTGGCCTGGTGGGCCCTCTACTGGTGTGCAAG
GCT
GGGGCCTTGGGTGCAGATGGCAAGCAGAAAGGAGTGGATAAAGAATTTTTTCTCCTCTTCACTGTGT
TT
GATGAGAATGAGAGCTGGTACAACAATGCCAATCAGGCAGCTGGTATGTTGGATTCCCGACTGCTCTC
A
GAGGATGTCGAGGGCTTCCAGGACTCCAATCGAATGCATGCTATTAATGGATTTCTGTTCTCTAACCTG
CCC
AGGCTGGACATGTGCAAGGGTGATACTGTGGCCTGGCACCTGCTTGGCCTGGGCACAGAGACTGATG
TA
CATGGGGTAATGTTCGAGGGCAACACTGTGCAGCTTCAGGGCATGAGGAAAGGTGCAGTCATGCTCTT
T
CCTCACACCTTTGTGACGGCCATCATGCAGCCTGACAATCCTGGAATATTTGAAATCTACTGCCAAGCA
GGC
AGCCACCGAGAGGAAGGGATGCAGGCAATTTATAATGTCTCTCAGTGTTCTAGTCATCAAGACAGCC
CA
CGCCAACACTACCAAGCTTCAAGAGTCTACTATATCATGGCAGAAGAGATAGAGTGGGATTACTGCCC
T
GATAGAAGCTGGGAACTGGAATGGCATAACACATCTGAGAAAGACAGCTATGGCCATGTTTTCCTGAGC
AAT
AAAGATGGGCTCCTGGGTTCCAAATATAAGAAAGCTGTATTCAGGGAATACACTGATGGTACTTTCA
GA
ATACCTCGGCCAAGGTCTGGACCAGAGGAGCACTTGGGAATCCTGGGTCCACTTATCAGAGGAGAGGT
T
GGTGATATCTTGACTGTAGTGTTCAAGAATAAGGCCAGTCGACCATATTCTATACATGCCCATGGAGTT
CTA
GAATCTAACACTGGCGGGCCACAGGCTGCTGAGCCTGGTGAAGTACTTACTTACCAGTGGAACATCC
CA
GAAAGATCTGGTCCTGGTCCTAGTGACTCTGCTTGTGTTTCCTGGATTTATTATTCTGCAGTGGATCC
C
ATCAAGGACATGTATAGTGGTCTGGTTGGACCCCTAGTCATCTGCAGAAATGGTATCTTGGAACCCAAT
GGA
GGCCGGAATGATATGGACCGGGAATTTGCCTTGTTGTTTTTGATCTTTGATGAGAACCAATCTTGGT
AT
CTGAAGGAGAATATTGCAACATATGGACCTCAAGAATCAAGTCATGTTAACTTGAAGGATGCCACCTT
C
CTAGAGAGCAATAAAATGCATGCTATCAATGGGAAACTCTATGCAAACCTCAGGGGTCTTACTGTATAC
CAA
GGAGAACGAGTAGCCTGGTACATGCTAGCCATGGGCCAAGATACTGACATTCACACTGTACACTTCC
AT
GCAGAGAGTTTCCTCTATCAGAATGGGCAAAGTTACAGGGCAGATGTGGTGGATCTCTTCCCAGGAAC
A
TTTGAAGTTGTGGAGATGGTAGCCAGCAACCCTGGGACATGGCTGATGCACTGCCATGTGACTGACCAT
GTT
CATGCTGGCATGGAGACCATCTTTACGGTCTTGTCTCATGAAGAACATTTCAGCACTATGACCACTA
TT
ACTAAAGAGATTGGAAAAGCAGTGATTCTAAGGGACATTGGAGGTGACAATGTGAAGATGCTGGGCAT
G
AACATTCCCATAAAGGATGTAGAGATTCTGTCTTCTGCTTTGATTGCCATATGTGTGCTTCTGTTGCTC
ATT
GCTCTGGCTCTTGGTGGTGTAGTCTGGTACCAGCATCGACAAAGAAAGCTTCGGCGCAACAGGAGGT
CC
ATTCTTGATGATAGCTTCAAGCTTCTCTCTCTCAAGCAATAA


Translation (1157 aa):
MKAGHLLWALLLMHSLWSIPTDGAIRNYYLGIQDMQWNYAPKGRNVITNQTLNNDTVASSFLKSGKNRIG
S
SYKKTVYKEYSDGTYTEEIAKPAWLGFLGPLLQAEVGDVILIHLKNFASRPYTIHPHGVFYEKDSE
GSL
Y
PDGSSGYLKADDSVPPGGSHVYNWSIPESHAPTEADPACLTWIYHSHVDAPRDIATGLIGPLITCKR
GT
L
DGNSPPQRKDVDHNFFLLFSVIDENLSWHLDDNIATYCSDPASVDKEDGAFQDSNRMH
AINGFVFGNLP
E
LSMCAQKHVAWHLFGMGNEIDVHTAFFHGQMLSIRGHHTDVANIFPATFVTAEMVPQKSGTWLISCEVN
S
HLR
SGMQAFYKVDSCSMDPPVDQLTGKVRQYFIQAHEIQWDYGPIGYDGRTGKSLREPGSGPDKYFQKS
S
SRIGGTYWKVRYEAFQDETFQERVHQEEETHLGIL
GPVIRAEVGDTIQVVFYNRASQPFSIQPHGVFYE
K
NSEGTVYND
GTSHPKVAKSFEKVTYYWTVPPHAGPTAQDPACLTWMYFSAADPTRDTNSGLVGPLLVCK
A
GALGADGKQ
KGVDKEFFLLFTVFDENESWYNNANQAAGMLDSRLLSEDVEGFQDSNRMHAINGFLFSNL
P
RLDMCKGDTVAWHLLGLGTETDVHGVMFEGNTVQLQGMRKGAVMLFPHTFVTAIMQPDNP
GIFEIYCQA
G
SHREEGMQAIYNVSQCSSHQDSPRQHYQASRVYYIMAEEIEWDYCPDRSWELEWHNTSEKD
SYGHVFLS
N
KDGLLGSKYKKAVFREYTDGTFRIPRPRSGPEEHLGIL
GPLIRGEVGDILTVVFKNKASRPYSIHAHGV
L
ESNTGGPQAAEP
GEVLTYQWNIPERSGPGPSDSACVSWIYYSAVDPIKDMYSGLVGPLVICRNGILEPN
G
GRNDMDREFALLFLIFDENQSWYLKENIATYGPQESSHVNLKDATFLESNKMH
AINGKLYANLRGLTVY
Q
GERVAWYMLAMGQDTDIHTVHFHAESFLYQ
NGQSYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVTDH
V
HAGMETIFTVLSHE
EHFSTMTTITKEIGKAVILRDIGGDNVKMLGMNIPIKDVEILSSALIAICVLLLL
I
ALALGGVVWYQHRQRKLRRNRRSILDDSFKLLSLKQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser