NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30216.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30216.1 Public Mus musculus X Avpr2 16 104 75 CCDS HistoryNCBI Gene:12000Re-query CCDS DB by CCDS ID:30216.1Re-query CCDS DB by GeneID:12000

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 30216.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033765 ENSMUSP00000033765 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033765Link to Ensembl Protein Viewer:ENSMUSP00000033765Re-query CCDS DB by Nucleotide ID:ENSMUST00000033765Re-query CCDS DB by Protein ID:ENSMUSP00000033765
Original member Current member EBI,WTSI OTTMUST00000042869 OTTMUSP00000019256 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042869Link to Vega Protein Viewer:OTTMUSP00000019256Re-query CCDS DB by Nucleotide ID:OTTMUST00000042869Re-query CCDS DB by Protein ID:OTTMUSP00000019256
Original member Current member NCBI NM_019404.2 NP_062277.1 Accepted alive Link to Nucleotide Sequence:NM_019404.2Link to Protein Sequence:NP_062277.1Re-query CCDS DB by Nucleotide ID:NM_019404Re-query CCDS DB by Protein ID:NP_062277Link to BLink:NP_062277.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062277.1 371 O88721 371 100% 0 0

Chromosomal Locations for CCDS 30216.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 73892244 73892268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73892624 73893508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73893669 73893874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1116 nt):
ATGATCCTGGTGTCTACCACGTCTGCAGTGCCTGGGGCCCTTTCGTCCCCTAGCTCTCCCAGCAACAGCA
GC
CAGGAGGAGCTACTGGATGACCGAGACCCGCTGTTAGTCCGGGCTGAACTGGCCCTGCTATCTACAAT
T
TTTGTGGCTGTGGCCTTGAGCAATGGCCTAGTGCTTGGGGCCCTAATACGACGGGGTCGGCGTGGACGC
TGG
GCACCCATGCACGTCTTCATCAGTCATTTGTGCCTAGCTGACCTGGCTGTGGCTCTGTTTCAAGTGC
TG
CCCCAGCTGGCTTGGGATGCCACCGACCGCTTCCATGGCCCTGATGCCTTGTGTCGGGCCGTCAAGTA
C
CTGCAGATGGTGGGCATGTATGCCTCTTCCTACATGATCCTGGCCATGACACTAGACCGCCATCGCGCC
ATC
TGCCGCCCTATGCTGGCATACCGCCATGGAGGTGGGGCTCGCTGGAACAGGCCAGTGCTGGTGGCCT
GG
GCCTTCTCACTCCTTCTCAGCCTGCCTCAGCTCTTCATCTTTGCTCAACGTGATGTGGGAAATGGCAG
T
GGGGTATTTGATTGCTGGGCCCGATTTGCAGAGCCATGGGGCCTTCGTGCCTATGTCACCTGGATCGCC
TTG
ATGGTGTTTGTGGCACCTGCCCTAGGCATTGCTGCCTGCCAGGTTCTTATCTTCCGGGAGATACATG
CC
AGTCTGGTGCCAGGGCCATCTGAAAGGGCAGGGAGGCGCCGCAGAGGACACCGGACAGGAAGTCCCAG
C
GAGGGAGCCCATGTATCAGCAGCCATGGCCAAGACCGTGAGGATGACACTGGTGATTGTGATTGTCTAC
GTG
CTGTGCTGGGCACCCTTCTTCCTTGTGCAGCTGTGGGCAGCGTGGGATCCAGAAGCTCCTCTGGAAA
GA
CCCCCCTTTGTGTTGCTCATGCTGCTGGCTAGCCTTAACAGCTGTACCAACCCCTGGATCTATGCTTC
C
TTCAGTAGCAGTGTCTCCTCGGAGTTGCGTAGCCTGCTTTGCTGTGCTCAGAGGCACACCACACACAGC
CTG
GGTCCTCAAGATGAGTCCTGTGCCACAGCCAGCTCCTCTCTGATGAAGGATACACCCTCCTGA


Translation (371 aa):
MILVSTTSAVPGALSSPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLGALIRRGRRGR
W
APMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRA
I
CRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQRDVGNGSGVFDCWARFAEPWGLRAYVTWIA
L
MVFVAPALGIAACQVLIFREIHASLVPGPSERAGRRRRGHRTGSPSEGAHVSAAMAKTVRMTLVIVIVY
V
LCWAPFFLVQLWAAWDPEAPLE
RPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHS
L
GPQDESCATASSSLMKDTPS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser