NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30033.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30033.1 Public Mus musculus X Maoa 16 104 75 CCDS HistoryNCBI Gene:17161Re-query CCDS DB by CCDS ID:30033.1Re-query CCDS DB by GeneID:17161

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 30033.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026013 ENSMUSP00000026013 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026013Link to Ensembl Protein Viewer:ENSMUSP00000026013Re-query CCDS DB by Nucleotide ID:ENSMUST00000026013Re-query CCDS DB by Protein ID:ENSMUSP00000026013
Original member Current member EBI,WTSI OTTMUST00000041061 OTTMUSP00000018396 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041061Link to Vega Protein Viewer:OTTMUSP00000018396Re-query CCDS DB by Nucleotide ID:OTTMUST00000041061Re-query CCDS DB by Protein ID:OTTMUSP00000018396
Original member Current member NCBI NM_173740.3 NP_776101.3 Accepted alive Link to Nucleotide Sequence:NM_173740.3Link to Protein Sequence:NP_776101.3Re-query CCDS DB by Nucleotide ID:NM_173740Re-query CCDS DB by Protein ID:NP_776101Link to BLink:NP_776101.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_776101.3 526 Q64133 526 100% 0 0

Chromosomal Locations for CCDS 30033.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 16619841 16619913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16634182 16634276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16639064 16639201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16658568 16658672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16659445 16659536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16662317 16662458 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16664651 16664800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16665652 16665811 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16672847 16672943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16677555 16677608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16680814 16680871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16682201 16682298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16683964 16684075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16684982 16685044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 16685232 16685375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1581 nt):
ATGACGGATCTGGAGAAGCCCAGTATCACAGGCCACATGTTCGACGTAGTCGTGATTGGAGGCGGCATCT
CA
GGATTGGCTGCTGCCAAACTATTGTCAGAATACAAAATTAATGTCTTGGTTCTGGAAGCCCGGGATAG
A
GTTGGAGGAAGAACATATACTGTGAGGAATGAGCATGTTAAATGGGTAGATGTTGGTGGAGCTTATGTG
GGA
CCAACCCAGAACAGAATCTTACGCTTGTCTAAGGAGCTAGGCATAGAGACCTATAAAGTGAATGTCA
AT
GAGCGTCTAGTTCAATATGTCAAGGGGAAAACTTACCCATTCCGTGGTGCATTTCCACCTGTGTGGAA
C
CCCTTGGCATATTTGGATTACAACAACCTGTGGAGGACAATGGATGATATGGGAAAAGAGATCCCTGTT
GAT
GCACCATGGCAAGCAAGACATGCTGAGGAATGGGACAAGATAACCATGAAAGATCTCATTGATAAAA
TC
TGTTGGACAAAAACTGCTCGAGAATTTGCTTATCTTTTTGTGAACATTAATGTGACTTCTGAGCCTCA
T
GAGGTATCTGCCCTGTGGTTCTTGTGGTATGTGAGGCAGTGTGGAGGTACCTCTCGGATATTCTCAGTC
ACC
AATGGCGGCCAGGAACGGAAATTTGTAGGTGGCTCTGGCCAAATAAGTGAACAGATAATGGTCCTCC
TT
GGGGATAAAGTGAAGCTGAGCTCTCCTGTTACTTATATTGACCAAACAGATGACAACATCATTATAGA
A
ACACTGAATCATGAGCACTATGAGTGCAAATATGTAATTAGTGCCATCCCACCGGTTTTGACTGCCAAG
ATC
CACTTTAAACCAGAGCTTCCACCTGAGAGAAACCAATTAATTCAGCGTCTTCCAATGGGGGCTGTCA
TC
AAGTGCATGGTGTATTACAAGGAAGCCTTCTGGAAGAAAAAGGACTATTGTGGCTGCATGATAATTGA
A
GATGAGGAGGCTCCAATTTCAATCACTCTGGATGACACTAAACCAGATGGGTCAATGCCTGCCATCATG
GG
C
TTCATACTTGCCCGGAAAGCTGAACGACTTGCTAAACTACATAAAGACATAAGGAAGAGGAAAATCT
GT
GAGCTGTATGCCAAAGTTCTGGGATCTCAAGAAGCTTTATCTCCCGTCCATTATGAAGAGAAGAACTG
G
TGTGAGGAGCAGTACTCCGGGGGCTGCTACACAGCCTACTTCCCTCCTGGTATCATGACTCTGTATGGA
AG
G
GTGATTCGGCAGCCAGTAGGCAGGATTTACTTTGCAGGCACAGAGACAGCAACACAGTGGAGTGGCT
AC
ATGGAAGGTGCAGTTGAAGCTGGAGAACGAGCAGCTAGAGAGGTCTTGAATGCTCTAGGAAAAGTTGC
C
AAGAAGGATATATGGGTTCAAGAGCCTGAGTCCAAGGATGTTCCAGCTCTTGAAATTACCCACACCTTC
TTA
GAGAGGAACCTGCCTTCCGTGCCTGGTCTGCTCAAGATCACTGGTTTTTCCACTTCTGTGGCTCTTC
TC
TGCTTTGTATTGTACAAGTTTAAACAGCCCCAGTCCTGA


Translation (526 aa):
MTDLEKPSITGHMFDVVVIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHVKWVDVGGAYV
G
PTQNRILRLSKELGIETYKVNVNERLVQYVK
GKTYPFRGAFPPVWNPLAYLDYNNLWRTMDDMGKEIPV
D
APWQARHAEEWDKITMKDLIDKICWT
KTAREFAYLFVNINVTSEPHEVSALWFLWYVRQCGGTSRIFSV
T
NGGQ
ERKFVGGSGQISEQIMVLLGDKVKLSSPVTYIDQTDDNIIIETLNHEHYECKYVISAIPPVLTAK
I
HFKPELPPERNQLIQRLPMGAVIKCMVYYKEAFWKKK
DYCGCMIIEDEEAPISITLDDTKPDGSMPAIM
G
FILARKAERLAKLHKDIRKRKICELYAKVLGSQEALSPVHYEEKNWCEEQYSGGCYTAYFPPGIMTLYG
R
VIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVQEPESKDVPALEITHTF
L
ERNLPSVPGLLKITGFSTSVALLCFVLYKFKQPQS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser