NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29992.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29992.1 Public Mus musculus X Porcn 16 104 75 CCDS HistoryNCBI Gene:53627Re-query CCDS DB by CCDS ID:29992.1Re-query CCDS DB by GeneID:53627

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29992.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000089403 ENSMUSP00000086825 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000089403Link to Ensembl Protein Viewer:ENSMUSP00000086825Re-query CCDS DB by Nucleotide ID:ENSMUST00000089403Re-query CCDS DB by Protein ID:ENSMUSP00000086825
Original member Current member EBI,WTSI OTTMUST00000043786 OTTMUSP00000019662 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043786Link to Vega Protein Viewer:OTTMUSP00000019662Re-query CCDS DB by Nucleotide ID:OTTMUST00000043786Re-query CCDS DB by Protein ID:OTTMUSP00000019662
Original member Current member NCBI NM_145907.3 NP_665914.1 Accepted alive Link to Nucleotide Sequence:NM_145907.3Link to Protein Sequence:NP_665914.1Re-query CCDS DB by Nucleotide ID:NM_145907Re-query CCDS DB by Protein ID:NP_665914Link to BLink:NP_665914.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_665914.1 455 Q9JJJ7-3 455 100% 0 0

Chromosomal Locations for CCDS 29992.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 8194176 8194277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8197975 8198085 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8199067 8199152 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8199231 8199294 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8199386 8199462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8201176 8201276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8201444 8201569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8201658 8201672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8203159 8203289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8203369 8203550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8203792 8203835 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8204196 8204388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8205565 8205700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1368 nt):
ATGGCCACCTTCAGCCGCCAGGAATTTTTCCAGCAGCTACTGCAGGGCTGTCTCCTGCCTACTGTCCAAC
AG
GGCCTTGACCAGATCTGGCTGCTTCTTACCATCTGCTTCGCCTGCCGCCTCCTTTGGAGGCTGGGGTT
A
CCGTCTTACCTGAAGCATGCAAGCACCGTGGCAGGTGGCTTCTTCAGCCTCTACCACTTCTTCCAGCTG
CAC
ATGGTTTGGGTCGTGCTGCTGAGCCTCCTGTGCTACCTCGTGCTGTTCCTCTGCCGACACTCCTCCC
AC
CGAGGCGTCTTCCTCTCCGTCACCATCCTCATCTACCTGCTCATGGGTGAGATGCACATGGTGGACAC
C
GTGACATGGCACAAGATGCGAGGGGCCCAGATGATCGTGGCCATGAAGGCGGTGTCTCTGGGCTTCGAC
CTG
GACCGGGGCGAGGTGGGTGCAGTGCCCTCACCTGTGGAGTTCATGGGCTACCTCTACTTTGTGGGCA
CC
ATCGTCTTTGGGCCCTGGATATCCTTCCACAGCTACCTACAGGCTGTCCAAGGCCGCCCACTGAGCCG
C
CGATGGCTGAAGAAGGTGGCCCGGAGCCTGGCGCTGGCCCTGCTGTGCCTTGTACTGTCCACTTGTGTG
GGC
CCCTACCTCTTCCCCTACTTCATCCCCCTCGACGGTGACCGACTCCTTCGCAAGGGCACCATGGTAA
G
G
TGGCTACGAGCCTACGAGAGTGCTGTCTCCTTCCACTTCAGCAACTATTTTGTGGGCTTTCTGTCTGA
G
GCCACAGCCACATTGGCCGGGGCTGGCTTCACGGAGGAGAAGGACCACCTGGAATGGGACCTGACAGTC
TCT
AGACCGTTGAATGTGGAGCTGCCCCGGTCCATGGTGGAAGTTGTCACAAGCTGGAACCTGCCCATGT
CT
TATTGGTTAAATAATTATGTTTTCAAAAATGCCCTTCGCCTGGGGACCTTCTCTGCTGTGCTGGTCAC
C
TATGCAGCCAGTGCCCTCCTGCATGGCTTCAGTTTCCACCTGGCTGCTGTGCTGCTGTCCCTGGCATTC
ATC
ACTTATGTGGAACATGTCCTCAGAAAGCGCCTGGCTCAGATCCTCAGTGCCTGCATCTTGTCAAAGC
GT
TGTCTGCCAGACTGTTCACATCGGCATCGCTTGGGCCTGGGGGTACGAGCCTTAAACTTGCTCTTTGG
G
GCCCTGGCTATCTTCCACCTGTCCTACCTGGGCTCCCTGTTTGATGTCGATGTGGACGACACCACAGAG
GAG
CAGGGCTACGGCATGGCATACACTGTCCACAAGTGGTCAGAGCTCAGCTGGGCCAGTCACTGGGTCA
CT
TTTGGATGCTGGATCTTCTACCGTCTCATAGGCTGA


Translation (455 aa):
MATFSRQEFFQQLLQGCLLPTVQQGLDQIWLLLTICFACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQL
H
MVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLM
GEMHMVDTVTWHKMRGAQMIVAMKAVSLGFD
L
DRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAVQGRPL
SRRWLKKVARSLALALLCLVLSTCV
G
PYLFPYFIPLDGDRLLR
KGTMVRWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTV
S
RPLNVELPRSMVEVVTSWNLPMSYWLNN
YVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLSLAF
I
TYVEH
VLRKRLAQILSACILSKRCLPDCSHRHRLGLGVRALNLLFGALAIFHLSYLGSLFDVDVDDTTE
E
Q
GYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser