NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29989.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29989.1 Public Mus musculus X Ebp 16 104 75 CCDS HistoryNCBI Gene:13595Re-query CCDS DB by CCDS ID:29989.1Re-query CCDS DB by GeneID:13595

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29989.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033509 ENSMUSP00000033509 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033509Link to Ensembl Protein Viewer:ENSMUSP00000033509Re-query CCDS DB by Nucleotide ID:ENSMUST00000033509Re-query CCDS DB by Protein ID:ENSMUSP00000033509
Original member Current member EBI,WTSI OTTMUST00000043741 OTTMUSP00000019639 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043741Link to Vega Protein Viewer:OTTMUSP00000019639Re-query CCDS DB by Nucleotide ID:OTTMUST00000043741Re-query CCDS DB by Protein ID:OTTMUSP00000019639
Original member Current member NCBI NM_007898.2 NP_031924.1 Accepted alive Link to Nucleotide Sequence:NM_007898.2Link to Protein Sequence:NP_031924.1Re-query CCDS DB by Nucleotide ID:NM_007898Re-query CCDS DB by Protein ID:NP_031924Link to BLink:NP_031924.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031924.1 230 P70245 230 100% 0 0

Chromosomal Locations for CCDS 29989.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 8185610 8185833 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8186644 8186774 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8186883 8186919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 8190079 8190379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (693 nt):
ATGACCACCAATACGGTCCCCTTGCACCCGTACTGGCCCAGGCACCTGAAGCTGGACAACTTCGTGCCTA
AT
GACCTCCCGACTTCGCATATCCTGGTTGGCCTCTTCTCCATCTCTGGGGGCCTAATTGTGATCACGTG
G
CTGTTGTCTAGCCGAGCTTCCGTCGTCCCACTTGGAGCTGGGCGGCGACTGGCCTTGTGCTGGTTTGCT
GTG
TGTACCTTCATTCACCTTGTGATCGAGGGCTGGTTCTCTCTCTACAATGGCATCCTTTTAGAAGACC
AA
GCCTTCTTATCCCAACTCTGGAAAGAGTATTCCAAGGGAGATAGCCGATATATCCTTAGTGACAGCTT
C
GTCGTCTGTATGGAGACTGTCACAGCTTGTCTCTGGGGACCACTCAGCCTATGGGTAGTGATTGCCTTT
CTC
CGCCAACAGCCCTTCCGCTTTGTCCTACAGCTTGTGGTGTCTATGGGCCAGATATACGGGGATGTGC
TG
TACTTCCTGACAGAGCTACACGAAGGACTCCAGCATGGGGAGATAGGCCACCCCGTTTATTTCTGGTT
C
TATTTTGTTTTCCTGAATGCTGTATGGTTGGTGATACCAAGCATCCTTGTGCTTGATGCCATAAAGCAT
CTC
ACTAGTGCCCAGAGCGTGCTGGACAGCAAAGTCATGAAAATTAAGAGCAAGCATAACTAA


Translation (230 aa):
MTTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAGRRLALCWFA
V
CTFIHLVIEGWFSLYNGILLEDQAFLSQL
WKEYSKGDSRYILSDSFVVCMETVTACLWGPLSLWVVIAF
L
RQQPFRFVLQLVVSM
GQIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVWLVIPSILVLDAIKH
L
TSAQSVLDSKVMKIKSKHN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser