NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29769.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29769.1 Public Mus musculus 19 Htr7 16 104 75 CCDS HistoryNCBI Gene:15566Re-query CCDS DB by CCDS ID:29769.1Re-query CCDS DB by GeneID:15566

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29769.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000164639 ENSMUSP00000126847 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164639Link to Ensembl Protein Viewer:ENSMUSP00000126847Re-query CCDS DB by Nucleotide ID:ENSMUST00000164639Re-query CCDS DB by Protein ID:ENSMUSP00000126847
Original member Current member EBI,WTSI OTTMUST00000092081 OTTMUSP00000050808 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000092081Link to Vega Protein Viewer:OTTMUSP00000050808Re-query CCDS DB by Nucleotide ID:OTTMUST00000092081Re-query CCDS DB by Protein ID:OTTMUSP00000050808
Original member Current member NCBI NM_008315.2 NP_032341.2 Accepted alive Link to Nucleotide Sequence:NM_008315.2Link to Protein Sequence:NP_032341.2Re-query CCDS DB by Nucleotide ID:NM_008315Re-query CCDS DB by Protein ID:NP_032341Link to BLink:NP_032341.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032341.2 448 P32304 448 100% 0 0

Chromosomal Locations for CCDS 29769.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

Chromosome Start Stop Links
19 35960357 35960399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 35969309 35970064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36056706 36057253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1347 nt):
ATGATGGACGTTAACAGCAGCGGCCGCCCCGACCTCTACGGCCATCTCCGCTCTCTCATCCTGCCGGAGG
TG
GGGCGCAGGCTGCAGGACCTGAGCCCCGACGGTGGCGCCCACTCGGTGGTGAGCTCCTGGATGCCGCA
C
CTGCTGAGCGGCTTCCCAGAGGTGACAGCTAGCCCGGCGCCCACCTGGGACGCGCCCCCGGACAATGTC
TCC
GGCTGCGGGGAGCAGATCAACTATGGCAGAGTCGAGAAAGTTGTGATCGGCTCCATCCTGACGCTCA
TC
ACGCTGCTGACGATCGCGGGCAACTGCCTGGTGGTGATCTCGGTGTGCTTTGTCAAGAAGCTCCGCCA
G
CCCTCCAACTACCTGATTGTGTCCCTGGCGCTGGCTGACCTCTCGGTGGCCGTGGCGGTCATGCCTTTC
GTT
AGTGTCACGGACCTCATCGGGGGCAAGTGGATCTTCGGCCACTTCTTCTGCAACGTCTTCATCGCCA
TG
GACGTCATGTGCTGCACGGCCTCGATCATGACCCTGTGCGTGATCAGCATCGACAGGTACCTTGGGAT
C
ACCAGGCCCCTCACGTACCCCGTGAGGCAGAATGGGAAATGTATGGCCAAAATGATTCTGTCGGTCTGG
CTT
CTCTCTGCCTCCATCACCTTACCTCCTCTCTTCGGATGGGCTCAGAATGTGAACGATGACAAAGTGT
GC
TTGATCAGCCAGGATTTTGGCTACACGATCTACTCCACCGCAGTGGCGTTTTATATCCCCATGTCGGT
C
ATGCTGTTCATGTACTATCAGATTTACAAGGCCGCCAGGAAGAGCGCAGCCAAACACAAGTTCTCAGGC
TTC
CCACGCGTGCAGCCGGAGAGCGTCATCTCCCTGAATGGCGTGGTGAAACTCCAGAAGGAGGTGGAAG
AG
TGTGCGAACCTTTCGAGACTGCTCAAACACGAAAGGAAAAACATTTCCATCTTCAAGAGGGAACAGAA
A
GCAGCCACTACCTTGGGGATCATCGTGGGAGCCTTCACGGTGTGCTGGCTGCCGTTTTTCCTCTTGTCC
ACA
GCAAGGCCCTTTATCTGTGGCACCTCCTGTAGCTGCATCCCGCTGTGGGTGGAGAGGACATGTCTGT
GG
CTGGGCTATGCAAACTCTCTCATTAACCCTTTTATATATGCCTTCTTCAACCGGGACCTGAGGACCAC
C
TATCGTAGCCTACTCCAGTGCCAGTACCGGAATATCAACCGGAAGCTCTCTGCTGCAGGCATGCACGAA
GCC
CTGAAACTTGCTGAGAGGCCTGAGAGAAGCGAGTTTGTGCTACAAAACTGTGACCACTGTGGGAAAA
AA
GGTCATGATACATGA


Translation (448 aa):
MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNV
S
GCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPF
V
SVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID
RYLGITRPLTYPVRQNGKCMAKMILSVW
L
LSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSG
F
PRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLS
T
ARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
A
LKLAERPERSEFV
LQNCDHCGKKGHDT



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser