NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29082.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29082.1 Public Mus musculus 18 Dsg4 16 104 75 CCDS HistoryNCBI Gene:16769Re-query CCDS DB by CCDS ID:29082.1Re-query CCDS DB by GeneID:16769

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29082.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000019426 ENSMUSP00000019426 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019426Link to Ensembl Protein Viewer:ENSMUSP00000019426Re-query CCDS DB by Nucleotide ID:ENSMUST00000019426Re-query CCDS DB by Protein ID:ENSMUSP00000019426
Original member Current member EBI,WTSI OTTMUST00000069707 OTTMUSP00000035447 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000069707Link to Vega Protein Viewer:OTTMUSP00000035447Re-query CCDS DB by Nucleotide ID:OTTMUST00000069707Re-query CCDS DB by Protein ID:OTTMUSP00000035447
Original member Current member NCBI NM_181564.2 NP_853543.1 Accepted alive Link to Nucleotide Sequence:NM_181564.2Link to Protein Sequence:NP_853543.1Re-query CCDS DB by Nucleotide ID:NM_181564Re-query CCDS DB by Protein ID:NP_853543Link to BLink:NP_853543.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_853543.1 1041 Q7TMD7 1041 100% 0 0

Chromosomal Locations for CCDS 29082.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

Chromosome Start Stop Links
18 20436309 20436356 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20446257 20446292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20446824 20446955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20449215 20449370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20449679 20449823 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20451748 20451914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20452939 20453073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20454657 20454842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20456800 20457071 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20458483 20458622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20461233 20461451 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20462378 20462683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20464817 20464956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20465109 20465172 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20466475 20466683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20470833 20471603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3126 nt):
ATGGACTGGCTTCTCTTCAGAAATATTTGCCTTCTGATCTTATTTATGGTGGTACTGGGAGTAAACAGTG
AA
TTTATCGTTGAGGTAAAAGAATTAGACATTGAAAATGGCACAACAACCTGGCAGACTGTCAGAAGACA
A
AAGCGGGAGTGGATCAAGTTTGCGGCAGCCTGTCGGGAGGGCGAGGACAACTCCAAGAGGAATCCAATT
GCC
AGAATTAGATCAGACTGTGAAGTAAGCCAGAGGATAACCTATCGAATCTCTGGAGCGGGGATTGATC
GG
CCACCTTACGGAGTGTTCACCATCAACCCTCGGACTGGAGAAATCAATATTACCTCAGTGGTGGACAG
A
GAGATAACCCCACTGTTCCTGATCCATTGCCGAGCTCTCAACTCCCGAGGAGAAGACTTGGAGAGACCA
CTG
GAGCTCAGAGTGAAAGTCATGGATGTGAACGACAACCCCCCAGTCTTCACTCAGAATGTGTACACAG
CC
AACATTGAAGAGAACAGCGACGCCAATGCACTGGTGGTAAAGTTAAGTGCCACAGATGCAGATGAAGA
C
AATCACTTGAATTCTAAAATTGCATACAAGATCATCTCCCAGGAGCCTGCTGGTGCACCCATGTTCATG
GTG
AACAGGTACACTGGAGAAGTCCGCACGATGTCCAATTTCCTTGACAGAGAGCAACACAGTATGTACA
AT
CTACTGGTGAGGGGCTCAGATCGGGATGGAGCCACAGATGGGCTGTCCTCTGAATGTGACTGCAGAAT
C
AAGATTTTGGATGTCAATGATAATTTCCCCATCTTGGAGAAGACCTCATACTCAGCAAGTATTGAAGAA
AAT
TGTTTGAGCTCAGAACTGATACGACTACAAGCAATCGATCTGGATGAAGAAGGCACTGATAACTGGT
TG
GCACAATACTCCATCCTCTCTGGCAATGATGGGAACTGGTTTGAAATCCAAACAGATCCAAAAACCAA
T
GAAGGCATTTTGAAAGTGGTCAAGATGCTGGATTATGAACAAGAACCTAACATTTACCTCAGCATTGGA
GTT
AGAAACCAAGCTGAGTTTCACCACTCAGTAGCATCTCAATTCCAAATGCACTCTACCCCTGTGAGAA
TC
CAGGTTGTTAACGTGCGGGAAGGACCGACCTTTAGCCCAAGTTCCATGACATTTAGTCTACGAGGAGG
A
ATGAGAGGAGCCTCCTTAATGAACTATGTGCTTGGCACATACACAGCCATAGATATGGACACAGGAAAC
CCT
GCAACCAATGTCAGGTATGTCATAGGGCATGATGCAGGCAGCTGGTTAAAAGTTGATTCAAGGACTG
GT
GAGATACAGTTTTCTAGGGAATTTGACATGAAGTCAAAATATATTACGGATGGGATATATGCAGCACA
G
ATCCTGGCTATAGATGATGGCTCTGGGAGAACAGCTACAGGAACCATATGCATTGAGATTCCTGATGCC
AAC
GATTACTGTCCCGTCATTTATGCTGAAAGCAGGAGTGTCTGCACCCATGCTTCGTCTGTCAGGATCT
AT
GTCAACGATCATTCTTTCGGGTCTCCCTTTACCTTTTGTGTAGTTGATGAGTCACCAGACATAGCTAA
T
ATATGGGATATCAGGTCCATCAATGGAACCTCTGCAATCCTTATGACTGAGCAGACTTTGTCTCCAGGA
CCC
TACCAAATCCCCATCCTCGTGAAGGACAGTCACAACCGAGCATGTGAATTGCCACAGACAGTGCTGT
TA
GATGCCTGCTTTTGTGATGACCACCATGTGTGCTTGCACTCCAGTACCACGGGCATCTACACTGGAGA
C
ATCACCTGGGTGACTGATGACATGTATGGGACTGTCACTGATGATGGAGTTAGGCAGTCAAACGTCGGA
CTT
GGCCCAGCAGGGATTGGCATGATTATTTTGGGGCTCTTGCTACTGCTCTTGTCACCCCTTTTACTGC
TC
ATGTGTTGCTGCAAGCGAAGACAGCCAGAAGGCCTGGGGACAAGGTTTGCCCCTGTGCCTGAGGGAGG
C
GAAGGAGTGATGCAGCCCTGGAGAATAGAGGGGGCTCATCCAGAAGACAGGGATGTATCAAATATTTGT
GTA
CCCATGACAGCCTCTAATACCCAAGATCGCATTGATTCATCTGAAATCTACACCAATACTTACGCTG
GT
GGAGGAACAGTGGAAGGGGGCGTGTCAGGAGTGGAGCTCAATACAGGTGTTGGGACAGCCACAGGCAT
G
GTGGCTGCAGGAGCAACAGGGACCCTAAGGAAGAGGAGTTCAACTATAGGGACTCTTCGGGAATACCAA
GAC
ACTGGCATGAACATGGCCTTCCTGGACAGCTACTTCTCCGAGAAAGCGTATGCATATGCAGATGAAG
AT
GAAGGCCGACCAGCCAATGACTGCCTGCTCATTTATGATCACGAAGGAGCTGGGTCACCCGTGGGCTC
C
ATTGGCTGCTGCAGTTGGATTGTGGATGACTTAGACGAAAGCTACATAGAGACTTTGGATCCAAAGTTC
AGG
ACTCTAGCTGAAATCTGCTTGGACACAGAGATTGAACCCTTCCCTTCACACCAGGCCTGTATACCAA
TC
AGCACTGACCTCCCTCTGCTGGGGCCTAATTACTTTGTCAATGAGTCTTCAGGAATGACTCTCTCAGA
G
GCTGAATTCCAAGCAGAAATGGCAGCAGCCTCTGAACCCATGATTCATGGGGACATCATAGTGACTGAG
ACC
TACACTACTTCTGACCCATGTGTCCAACCCACAACGATTGTCTTTGACTCTCAGATTCCACCAAACG
TA
GTCGTGACCGAAACCGTAATGGCACCTGTCTACGATGTTCAAGGGAACATTTGTGTGCCTGCTGAGAT
A
GCCAACACACACAATGTATACTATGCTGAGAGAGTGGTGGCTAGCCCTGGTATACCTGACATGGGCAAC
AGT
AACATTAGTGATGCATGTATAGGACCAGTGATGAGCGGCGGTATTTTGGTAGGGCCAGAAATTCAAG
TG
ACACAAATGATGAGCCCAGACATTCACATAAGCCAAACCACAGGCTCCACCTCCCCAATGACGTCTCA
A
CACCGAGTAACCAGATACAGCAATATGCACTACTCCCGACAGTAA


Translation (1041 aa):
MDWLLFRNICLLILFMVVLGVNSEFIVEVKELDIENGTTTWQTVRRQKREWIKFAAACREGEDNSKRNPI
A
R
IRSDCEVSQRITYRISGAGIDRPPYGVFTINPRTGEINITSVVDREITPLFLIHCRALNSRGEDLERP
L
ELRVKVMDVNDNPPVFTQNVYTANIEENSDA
NALVVKLSATDADEDNHLNSKIAYKIISQEPAGAPMFM
V
NRYTGEVRTMSNFLDRE
QHSMYNLLVRGSDRDGATDGLSSECDCRIKILDVNDNFPILEKTSYSASIEE
N
CLSSELIRLQAIDLDEEGTDNWLAQYSILSGNDGNWFEIQTDPKTNEGILKVVK
MLDYEQEPNIYLSIG
V
RNQAEFHHSVASQFQMHSTPVRIQVVNVREGPTFSPSSMTFSLRGGMRGASLMNYVLGTYTAIDMDTGN
P
ATNV
RYVIGHDAGSWLKVDSRTGEIQFSREFDMKSKYITDGIYAAQILAIDDGSGRTATGTICIEIPDA
N
DYCPVIYAESRSVCTHASSVRIYVNDHSFGSPFTFCVVDESPDIANIWDIRSIN
GTSAILMTEQTLSPG
P
YQIPILVKDSHNRACELPQTVLLDACFCDDHHVCLHSSTTGIYTGDITWVTDDMYGTVTDDGVRQSNVG
L
GPAGIGMIILGLLLLL
LSPLLLLMCCCKRRQPEGLGTRFAPVPEGGEGVMQPWRIEGAHPEDRDVSNIC
V
PMTASNTQDRIDSS
EIYTNTYAGGGTVEGGVSGVELNTGVGTATGMVAAGATGTLRKRSSTIGTLREYQ
D
TGMNMAFLDSYFSE
KAYAYADEDEGRPANDCLLIYDHEGAGSPVGSIGCCSWIVDDLDESYIETLDPKF
R
TLAEICLDTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGMTLSEAEFQAEMAAASEPMIHGDIIVTE
T
YTTSDPCVQPTTIVFDSQIPPNVVVTETVMAPVYDVQGNICVPAEIANTHNVYYAERVVASPGIPDMGN
S
NISDACIGPVMSGGILVGPEIQVTQMMSPDIHISQTTGSTSPMTSQHRVTRYSNMHYSRQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser